[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55698.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:158 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->107 PF07423 * DUF1510 1.5e-05 33.8 65/217  
:HMM:PFM   122->157 PF01476 * LysM 0.00038 30.3 33/44  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55698.1 GT:GENE ACF55698.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1469227..1469703) GB:FROM 1469227 GB:TO 1469703 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55698.1 GB:DB_XREF GI:194357250 LENGTH 158 SQ:AASEQ MAKEPWQEDIYDQEESRAERRHRNHGGADRMANRILTILASIFFVIVVVMVIVLIYLSSGGSNRTAALKDFHDSDASVVQISSSSSSQPEQSSEPESTSSSSEEAANPEGTIKVLAGEGEAAIAARAGISIAQLEALNPGHMATGSWFANPGDVIKIK GT:EXON 1|1-158:0| TM:NTM 1 TM:REGION 36->58| SEG 42->55|iffvivvvmvivli| SEG 82->104|ssssssqpeqssepestssssee| SEG 116->132|agegeaaiaaragisia| HM:PFM:NREP 2 HM:PFM:REP 30->107|PF07423|1.5e-05|33.8|65/217|DUF1510| HM:PFM:REP 122->157|PF01476|0.00038|30.3|33/44|LysM| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,13-26,74-112| PSIPRED cccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHcccEEEEEEEEEEEEcccccccHHHHcccccccccEEEEEccccccccccccccccccccccccccccEEEEEccccHHHHHHHHcccHHHHHHccHHHccccEEEcccccEEEEc //