[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55700.1
DDBJ      :             hypothetical protein
Swiss-Prot:Y1647_STRP4  RecName: Full=UPF0348 protein SPG_1647;

Homologs  Archaea  0/68 : Bacteria  189/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.26.1
:365 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->108 3gmiA PDBj 6e-09 31.3 %
:RPS:PDB   10->119 3do8A PDBj 3e-12 20.4 %
:RPS:SCOP  1->121 1cozA  c.26.1.2 * 1e-12 16.2 %
:HMM:SCOP  2->210 1f9aA_ c.26.1.3 * 1.8e-17 25.5 %
:RPS:PFM   1->353 PF05636 * DUF795 1e-86 50.1 %
:HMM:PFM   1->360 PF05636 * DUF795 1.3e-151 51.9 360/388  
:BLT:SWISS 1->365 Y1647_STRP4 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55700.1 GT:GENE ACF55700.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1596705..1597802) GB:FROM 1596705 GB:TO 1597802 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF55700.1 GB:DB_XREF GI:194357252 LENGTH 365 SQ:AASEQ MTITGIIAEFNPFHNGHKYLLDQAEGLKIVAMSGNFMQRGEPAIVDKWTRAQMALENGADLVVELPFLVSVQAADFFGQGAVDILDRLGIDSLVFGTEEVRDYQKIADLYTEKGAEMEKFVENLPDSLSYPQKTQAMWKEFAGLDFSGNTPNHVLALAYAKAVAGRNIKLHPIQRQGAGYHSVNKDVDFASATALRQHQKDQDFLERFMPSVALFEQASKVIWEDYFPLLRYQILSNPDLTTIYQVNQEMAVRIKEAIKTAQSVEELVELVTTKRYTKARVRRLLTYILVQARESDLPEGIHVLGFTEKGRQHLKYLKGQVSLVSRIGKEPWDVMTQKADQIYQLGNPSIAEQNFGRVPIRIETN GT:EXON 1|1-365:0| SW:ID Y1647_STRP4 SW:DE RecName: Full=UPF0348 protein SPG_1647; SW:GN OrderedLocusNames=SPG_1647; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->365|Y1647_STRP4|0.0|100.0|365/365| BL:PDB:NREP 1 BL:PDB:REP 9->108|3gmiA|6e-09|31.3|99/356| RP:PDB:NREP 1 RP:PDB:REP 10->119|3do8A|3e-12|20.4|103/135| RP:PFM:NREP 1 RP:PFM:REP 1->353|PF05636|1e-86|50.1|353/388|DUF795| HM:PFM:NREP 1 HM:PFM:REP 1->360|PF05636|1.3e-151|51.9|360/388|DUF795| RP:SCP:NREP 1 RP:SCP:REP 1->121|1cozA|1e-12|16.2|111/126|c.26.1.2| HM:SCP:REP 2->210|1f9aA_|1.8e-17|25.5|141/164|c.26.1.3|1/1|Nucleotidylyl transferase| OP:NHOMO 191 OP:NHOMOORG 189 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-1111111111111111111111111111111-11111111111111111111111111111111111211111111111111111111111111111111111111111111112111111111111111111111111111111111111-11-------111--1111-11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11--1111---11---1111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 182 STR:RPRED 49.9 SQ:SECSTR ccEEEEEEccccccHHHHHHHHHHTcEEEEEEcHHHHHHHccccccHHHHHHHHHHHHHHHHccccEEEEEcccEEEEccTTTTTTTccccEEEEcTTTHHHHHHHHHHHHHHTccccETcEEGGGHTHHHHHHHHHHHHHHHTTcccEEEEcccccTTcccccGGGGGccHHHHHHTHHHH####################################################################################################################################################################################### DISOP:02AL 1-1,364-366| PSIPRED cEEEEEEEEccccccHHHHHHHHcccEEEEEEcccHHHccccccccHHHHHHHHHHccccEEEEccEEEEccHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHcHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccEEEEcccccccccccccccEEHHHHHHHHHHccccHHHccccHHHHHHcccccHHHHHHHHHEEEcccHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEcHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHcccccccccccccEEEccc //