[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55704.1
DDBJ      :             GTP pyrophosphokinase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  848/915 : Eukaryota  35/199 : Viruses  1/175   --->[See Alignment]
a.211.1d.15.10d.218.1d.58.18
:740 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->343 1vj7A PDBj e-147 79.6 %
:BLT:PDB   392->452 3hvzA PDBj 1e-13 55.0 %
:BLT:PDB   661->737 2ko1A PDBj 1e-05 29.3 %
:RPS:PDB   151->348 3dkxA PDBj 4e-42 12.7 %
:RPS:PDB   366->454 2dwqA PDBj 3e-17 16.9 %
:RPS:PDB   584->739 3dc2A PDBj 2e-22 12.0 %
:RPS:SCOP  5->196 1vj7A1  a.211.1.1 * 5e-61 79.1 %
:RPS:SCOP  199->348 1vj7A2  d.218.1.8 * 2e-55 76.7 %
:RPS:SCOP  394->452 1nyqA2  d.15.10.1 * 3e-21 33.9 %
:RPS:SCOP  663->736 1y7pA2  d.58.18.12 * 2e-12 15.1 %
:HMM:SCOP  5->196 1vj7A1 a.211.1.1 * 6.5e-77 55.7 %
:HMM:SCOP  197->371 1vj7A2 d.218.1.8 * 7.8e-65 49.1 %
:HMM:SCOP  381->454 1wxqA2 d.15.10.2 * 5e-21 44.6 %
:HMM:SCOP  658->738 1u8sA2 d.58.18.5 * 5.6e-09 21.0 %
:RPS:PFM   240->349 PF04607 * RelA_SpoT 5e-35 63.0 %
:RPS:PFM   394->452 PF02824 * TGS 4e-13 50.8 %
:HMM:PFM   240->348 PF04607 * RelA_SpoT 9.6e-39 47.7 107/112  
:HMM:PFM   394->452 PF02824 * TGS 1.2e-23 49.2 59/60  
:HMM:PFM   50->149 PF01966 * HD 3.6e-11 22.0 100/118  
:HMM:PFM   668->731 PF01842 * ACT 1.9e-07 21.0 62/66  
:BLT:SWISS 1->740 RELA_STREQ 0.0 75.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55704.1 GT:GENE ACF55704.1 GT:PRODUCT GTP pyrophosphokinase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1492003..1494225) GB:FROM 1492003 GB:TO 1494225 GB:DIRECTION - GB:PRODUCT GTP pyrophosphokinase GB:NOTE identified by match to protein family HMM PF01966; match to protein family HMM PF02824; match to protein family HMM PF04607; match to protein family HMM TIGR00691 GB:PROTEIN_ID ACF55704.1 GB:DB_XREF GI:194357256 LENGTH 740 SQ:AASEQ MPKEVNLTGEEVVALTKEYLTEEDVHFVHKALVYAVECHSGQYRKSGEPYIIHPIQVAGILAKLKLDAVTVACGFLHDVVEDTDATLDDLEREFGPDVRVIVDGVTKLGKVEYKSIEEQLAENHRKMLMAMSEDIRVILVKLSDRLHNMRTLKHLRKDKQERIXKETMEIYAPLAHRLGISSVKWELEDLSFRYLNPTEFYKITHMMKEKRREREALVDEVVTKLEEYTTERHLKGKIYGRPKHIYSIFRKMQDKRKRFEEIYDLIAIRCILDTQSDVYAMLGYVHEFWKPMPGRFKDYIANRKANGYQSIHTTVYGPKGPIEFQIRTKEMHEVAEYGVAAHWAYKKGIKGQVNSKESAIGMNWIKEMMELQDQADDAKEFVDSVKENYLAEEIYVFTPDGAVRSLPKDSGPIDFAYEIHTKVGEKATGAKVNGRMVPLTTKLKTGDQVEIIANPNSFGPSRDWLNMVKTSKARNKIRQFFKNQDKELSVNKGREMLMAQFQENGYVANKFMDKRHMDQVLQKTSYKTEDSLFAAIGFGEIGAITVFNRLTEKERREEERAKAKAEAEELVKGGEVKVENKETLKVKHEGGVVIEGASGLLVRIAKCCNPVPGDDIVGYITKGRGVAIHRVDCMNLRAQENYEQRLLDVEWEDQYSSSNKEYMAHIDIYGLNRTGLLNDVLQVLSNTTKNISTVNAQPTKDMKFANIHVSFGIANLSTLTTVVDKIKSVPEVYSVKRTNG GT:EXON 1|1-740:0| BL:SWS:NREP 1 BL:SWS:REP 1->740|RELA_STREQ|0.0|75.5|738/739| SEG 548->583|nrltekerreeerakakaeaeelvkggevkvenket| BL:PDB:NREP 3 BL:PDB:REP 5->343|1vj7A|e-147|79.6|319/326| BL:PDB:REP 392->452|3hvzA|1e-13|55.0|60/63| BL:PDB:REP 661->737|2ko1A|1e-05|29.3|75/88| RP:PDB:NREP 3 RP:PDB:REP 151->348|3dkxA|4e-42|12.7|181/202| RP:PDB:REP 366->454|2dwqA|3e-17|16.9|89/354| RP:PDB:REP 584->739|3dc2A|2e-22|12.0|150/526| RP:PFM:NREP 2 RP:PFM:REP 240->349|PF04607|5e-35|63.0|108/112|RelA_SpoT| RP:PFM:REP 394->452|PF02824|4e-13|50.8|59/60|TGS| HM:PFM:NREP 4 HM:PFM:REP 240->348|PF04607|9.6e-39|47.7|107/112|RelA_SpoT| HM:PFM:REP 394->452|PF02824|1.2e-23|49.2|59/60|TGS| HM:PFM:REP 50->149|PF01966|3.6e-11|22.0|100/118|HD| HM:PFM:REP 668->731|PF01842|1.9e-07|21.0|62/66|ACT| GO:PFM:NREP 1 GO:PFM GO:0015969|"GO:guanosine tetraphosphate metabolic process"|PF04607|IPR007685| RP:SCP:NREP 4 RP:SCP:REP 5->196|1vj7A1|5e-61|79.1|172/172|a.211.1.1| RP:SCP:REP 199->348|1vj7A2|2e-55|76.7|150/154|d.218.1.8| RP:SCP:REP 394->452|1nyqA2|3e-21|33.9|59/59|d.15.10.1| RP:SCP:REP 663->736|1y7pA2|2e-12|15.1|73/73|d.58.18.12| HM:SCP:REP 5->196|1vj7A1|6.5e-77|55.7|192/192|a.211.1.1|1/1|HD-domain/PDEase-like| HM:SCP:REP 197->371|1vj7A2|7.8e-65|49.1|175/175|d.218.1.8|1/1|Nucleotidyltransferase| HM:SCP:REP 381->454|1wxqA2|5e-21|44.6|74/0|d.15.10.2|1/1|TGS-like| HM:SCP:REP 658->738|1u8sA2|5.6e-09|21.0|81/93|d.58.18.5|1/1|ACT-like| OP:NHOMO 1434 OP:NHOMOORG 886 OP:PATTERN -------------------------------1-----------------1------------------ 1111111111111111111-1111111111111111111112221111111111111111221111122211111111121111111122221222G--11111111111---------------1111111112111112111111111111111111111121122212111111111111111111111111111111222121211111111221111212222222221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111221211111111111112111111111111112111111111-11111111-111111111112111112112111111111111-11121111111-1111111111111111111111111111111111111111111----------KL319A52B52-224----1112112212222222222222222222222223222222222222222222222222222122222222211222212112111111111111111112211111232111111111111111111111111111222222222222222222222222222222--22222------22332232222222222-2212222222222222222222222222222222222222222322222222-222222222222--22222222222223222122222222222222222222222222222222222222222222222222222222222222223222222222222222112-1-111111111111--111111---1--11----111--1111111111111--- ------1-------1---------------------------------------------------------------------------------1-1---------8---111------------------------------------------12----3---11--11-14124V44443976A-6424----5 -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 608 STR:RPRED 82.2 SQ:SECSTR ####ccccHHHHHHHHHHHccHHHHHHTTcTTTEEEEEEHHHHHHTTccHHHHHHHHHHTTcEEEEEcHHHHccccTTcccccccccccHHHHHHHHHHHHHcTTGGGccEEEEEEETTEEEEEEEcTTTTccccEEEEEEEccccccGGcGGGccTTHHHHGGGGcccEEEcccccccccccccccEEEEEEEEEEEEHHHHHHHHHHHHcTTcccccEEcccHHHHHTTTTccTTTTTTTccccccTTcEEETTccGGGGccccHHHHEccGGGHHHHHHHHHTHHHHHHHHHHHHHTTcccHHHHHHHHHHHHTccHHHHHHHTTcHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHTHHHHHcccccEEEEEETTccHHHHHHHHccHHHHTEEEEEEEEEEEcTTccccTTEEEEEEEccc###############################################################################################################################TGGGcccccccccHHHHHHHHccEEEEEEEcccccccEEEEEEEEcTTccEEEEETTTTEEEEEEETTEEEEEEccccccEEEEEEEcccTTHHHHHHHHHHHTTccEEEEEEEcccccccEEEEEEEcccccHccHHHHHHHHHHHTccEEEEEE# DISOP:02AL 1-5,113-118,348-358,375-380,563-590,740-741| PSIPRED ccccHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHccccHHHHEEEEEEEEEEccHHHHHHHHHHHHHHcccccccHHcccccccccccEEEEEEEEEcccEEEEEEccHHHHHHHHHHEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccEEEEcccccEEEccccccHHHHHHHHcHHHHHHHcEEEEccEEcccccccccccEEEEEEccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccHHHHHHHHHHcccccHHHHHHHHccccccHHHHHHHHHHcccccHHHHcccccHHHHHHccccccccccccccccccccEEEcccccHHHHcccccccccccEEEEEEcccEEEEcccccHHHHHHHHccccEEEEEEcccccccccEEEEEEEEEEEccccHHHHHHHHHHHccccEEEEEEEEcccccEEEEEEEEEEccHHHHHHHHHHHHccccEEEEEEccc //