[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55712.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  47/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.2.18
:84 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->76 1z0pA PDBj 6e-26 68.1 %
:RPS:SCOP  1->76 1z0pA1  a.2.18.1 * 2e-25 68.1 %
:HMM:SCOP  1->77 1z0pA1 a.2.18.1 * 7.8e-39 74.0 %
:RPS:PFM   1->84 PF08930 * DUF1912 6e-28 84.5 %
:HMM:PFM   1->84 PF08930 * DUF1912 3.6e-51 76.2 84/84  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55712.1 GT:GENE ACF55712.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 495332..495586 GB:FROM 495332 GB:TO 495586 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF55712.1 GB:DB_XREF GI:194357264 LENGTH 84 SQ:AASEQ MSYEQEFMKEFEAWVNTQIMINDMAHKESQKVYEEDQDERAKDAMIRYESRLDAYQFLLGKFENFKAGKGFHDLPEGLFGERNY GT:EXON 1|1-84:0| BL:PDB:NREP 1 BL:PDB:REP 1->76|1z0pA|6e-26|68.1|72/73| RP:PFM:NREP 1 RP:PFM:REP 1->84|PF08930|6e-28|84.5|84/84|DUF1912| HM:PFM:NREP 1 HM:PFM:REP 1->84|PF08930|3.6e-51|76.2|84/84|DUF1912| RP:SCP:NREP 1 RP:SCP:REP 1->76|1z0pA1|2e-25|68.1|72/73|a.2.18.1| HM:SCP:REP 1->77|1z0pA1|7.8e-39|74.0|77/0|a.2.18.1|1/1|SPy1572-like| OP:NHOMO 47 OP:NHOMOORG 47 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 85.7 SQ:SECSTR ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH####ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccTTcccc######## DISOP:02AL 1-2,30-38,82-85| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccc //