[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55726.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:52 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->42 PF01110 * CNTF 0.00056 40.0 40/199  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55726.1 GT:GENE ACF55726.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 962514..962672 GB:FROM 962514 GB:TO 962672 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55726.1 GB:DB_XREF GI:194357278 LENGTH 52 SQ:AASEQ MGDKPISFRDADGNFVSAADVWNEKKLEELFNRLNPNRALRLARTKKENPSQ GT:EXON 1|1-52:0| SEG 30->44|lfnrlnpnralrlar| HM:PFM:NREP 1 HM:PFM:REP 3->42|PF01110|0.00056|40.0|40/199|CNTF| OP:NHOMO 20 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-------11111111111-------1-----1--111---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,41-53| PSIPRED cccccccEEcccccEEEHHHcccHHHHHHHHHHccccHHHHHHHHccccccc //