[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55730.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.29.8
:100 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  16->77 1tdpA  a.29.8.1 * 2e-11 29.0 %
:HMM:SCOP  6->99 1tdpA_ a.29.8.1 * 5e-24 41.5 %
:HMM:PFM   2->73 PF08951 * EntA_Immun 1.7e-16 25.0 72/75  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55730.1 GT:GENE ACF55730.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1078954..1079256) GB:FROM 1078954 GB:TO 1079256 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55730.1 GB:DB_XREF GI:194357282 LENGTH 100 SQ:AASEQ MMRNEFRERVEQLLQQKEINENSELSHLFRLAIQNLDRNEKYQSVMANLSQGLSLYLMTHHYQAPKSVIDFGLWIAKAPSQERGRLAFLQMLAQTLQGFR GT:EXON 1|1-100:0| HM:PFM:NREP 1 HM:PFM:REP 2->73|PF08951|1.7e-16|25.0|72/75|EntA_Immun| RP:SCP:NREP 1 RP:SCP:REP 16->77|1tdpA|2e-11|29.0|62/111|a.29.8.1| HM:SCP:REP 6->99|1tdpA_|5e-24|41.5|94/0|a.29.8.1|1/1|Bacteriocin immunity protein-like| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------11111111111----------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-8,100-101| PSIPRED cccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccc //