[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55731.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->113 2i7rA PDBj 4e-61 99.1 %
:RPS:PDB   1->115 3bqxA PDBj 2e-09 9.6 %
:RPS:SCOP  2->115 2i7rA1  d.32.1.2 * 6e-46 97.4 %
:HMM:SCOP  1->115 2i7rA1 d.32.1.2 * 3.4e-23 27.8 %
:HMM:PFM   34->107 PF00903 * Glyoxalase 5.9e-06 27.0 74/128  
:PROS 1->104|PS00430|TONB_DEPENDENT_REC_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55731.1 GT:GENE ACF55731.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 651421..651768 GB:FROM 651421 GB:TO 651768 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF00903 GB:PROTEIN_ID ACF55731.1 GB:DB_XREF GI:194357283 LENGTH 115 SQ:AASEQ MNLNQLDIIVSNVPQVCADLEHILDKKADYADDGFAQFTIGSHCLMLSQNHLVPLENFQSGIIIHIEVEDVDQNYKRLNELGIKVLHGPTVTDWGTESLLVQGPAGLVLDFYRMK GT:EXON 1|1-115:0| PROS 1->104|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| BL:PDB:NREP 1 BL:PDB:REP 2->113|2i7rA|4e-61|99.1|111/112| RP:PDB:NREP 1 RP:PDB:REP 1->115|3bqxA|2e-09|9.6|115/136| HM:PFM:NREP 1 HM:PFM:REP 34->107|PF00903|5.9e-06|27.0|74/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 2->115|2i7rA1|6e-46|97.4|114/115|d.32.1.2| HM:SCP:REP 1->115|2i7rA1|3.4e-23|27.8|115/0|d.32.1.2|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1--11111111111-------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 100.0 SQ:SECSTR ccccEEEEEEccHHHHHHHHHHTcEEcccEEEEEcccEEEEEEHHHHHHHHcccccccccccEEEcccGGGHHHHHHHHHTTcEEEEEEEccTTccEEEEEEcTTccEEEEEEcT DISOP:02AL 1-1| PSIPRED cccccEEEEEccHHHHHHHHHHHHccccccccccEEEEcccccEEEEEcccccccccccccEEEEEEEccHHHHHHHHHHcccEEEEcccccccccEEEEEEcccccEEEEEEEc //