[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55735.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   40->122 PF04892 * VanZ 2e-08 50.0 %
:HMM:PFM   15->126 PF04892 * VanZ 2.2e-33 46.5 99/133  
:BLT:SWISS 40->96 RFAL_SALTY 9e-05 31.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55735.1 GT:GENE ACF55735.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 682713..683096 GB:FROM 682713 GB:TO 683096 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF04892 GB:PROTEIN_ID ACF55735.1 GB:DB_XREF GI:194357287 LENGTH 127 SQ:AASEQ MGVGTPGIQHLGRLVFLLTPFNSLWKLGEVSDIGQLCWIFLQNILNVFLFFPLIFQLLYLFPNLRKTKKVLLFSFLVSLGIECTQLILDFFFDFNRVFEIDDLWTNTLGGYLAWLLYKRLHKNKVRN GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 40->96|RFAL_SALTY|9e-05|31.6|57/404| TM:NTM 3 TM:REGION 2->24| TM:REGION 38->60| TM:REGION 71->93| RP:PFM:NREP 1 RP:PFM:REP 40->122|PF04892|2e-08|50.0|78/123|VanZ| HM:PFM:NREP 1 HM:PFM:REP 15->126|PF04892|2.2e-33|46.5|99/133|VanZ| OP:NHOMO 44 OP:NHOMOORG 42 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-2-1-1-------121-------------------------------------------------------------1111---11111111111111-------------1111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,126-128| PSIPRED cccccccHHHHccEEEEEccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccHHHcc //