[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55747.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:368 amino acids
:PSIPRED
:HMM:PFM   191->218 PF12503 * CMV_1a_C 0.0007 39.3 28/85  
:BLT:SWISS 172->326 INLJ_LISMF 2e-10 36.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55747.1 GT:GENE ACF55747.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1370545..1371651) GB:FROM 1370545 GB:TO 1371651 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55747.1 GB:DB_XREF GI:194357299 LENGTH 368 SQ:AASEQ MNIILIAKPLRENTNTKANALNNGWARSGSEEFKKFSHFVGVXKGIVRTNVLTGKKLSDKIRKEVDSGDSKLGKGGYFSTGDVLLGKDVVSYTVQVFSENNERVGVNTQSHRVQYNLPILADFSVIQDTVEPSRTVVEKIIPKLNIPEEEKGKITEEIKKKKKTSELAELISENVKVRYVDEQGRLLSLKNDTGIGEKESDGTYITNKKQLIGTSYNVTDKKLSSMTTTDGKYYTFKEADTNSASLTGNIVSEGRTVTLVYRESEAPTTATVTANYYKEGSQEKLAESVIKADLAIGSEYTTESKTIEGKTTTEDKEDRVITRKTTYTLVATPANAYQKTVQQLTITTVRMLRKQWFPKQQPLLRRRL GT:EXON 1|1-368:0| BL:SWS:NREP 1 BL:SWS:REP 172->326|INLJ_LISMF|2e-10|36.2|127/916| SEG 148->164|eeekgkiteeikkkkkt| HM:PFM:NREP 1 HM:PFM:REP 191->218|PF12503|0.0007|39.3|28/85|CMV_1a_C| OP:NHOMO 11 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-121--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEEHHHcccccccccccccccccccHHHHHHHHHHHHHHccEEEEEEEccHHHHHHHHHHHcccccccccccEEEEEEEEccccccccEEEEEEccccEEEEEEEEEEEEccccEEccccEEEcccccccEEEEEEccccccccccccccccEEEEEEEEEEccccccccEEEEEEcccccEEEcccccccccccccccEEEcccEEccccEEEccccccccccccccEEEEEEccccccccccEEEccccEEEEEEEEccccccccEEEEEEccccccccccccccccccccccEEEEEEEEccccEEcccccccEEEEEEEEEEEEccccccEEEccccEEEEEEcccccccccccHHHHcc //