[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55752.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:216 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 65->197 Y431_MYCPN 4e-05 31.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55752.1 GT:GENE ACF55752.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 641622..642272 GB:FROM 641622 GB:TO 642272 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55752.1 GB:DB_XREF GI:194357304 LENGTH 216 SQ:AASEQ MVKVATQTPIISLFLLILSLETSFIPSIALNLSVVAFCILFMLYYRRFKMLAWMIILAILPSFANYWAVQLHGDASQAVMLGTRAFVTVCIGLVFVSSISLKELLLYLAQKGLSRSWSYALIVVFNSFPLIQQEIKSLKEACLLRGQELHFWSPLIYSKVLMTVFRWRHLYLRALSAHGYDEHAQLKNSYRTFYIPKKTKLIYLLFFLLLQTSLFL GT:EXON 1|1-216:0| BL:SWS:NREP 1 BL:SWS:REP 65->197|Y431_MYCPN|4e-05|31.0|126/100| TM:NTM 6 TM:REGION 13->35| TM:REGION 49->71| TM:REGION 82->104| TM:REGION 115->137| TM:REGION 152->174| TM:REGION 200->216| SEG 10->25|iislfllilsletsfi| SEG 201->215|liyllfflllqtslf| OP:NHOMO 27 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-11-1-1-111111---121-------------11111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccccHHHHHHHHHHHHHHHHcc //