[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55753.1
DDBJ      :             hypothetical protein
Swiss-Prot:PFBA_STRR6   RecName: Full=Plasmin and fibronectin-binding protein A;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.80.1
:708 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  213->420 1jrgA  b.80.1.1 * 2e-11 25.1 %
:HMM:SCOP  139->570 1h80A_ b.80.1.8 * 4e-47 32.0 %
:RPS:PFM   465->552 PF01803 * LIM_bind 6e-04 31.0 %
:HMM:PFM   8->30 PF04650 * YSIRK_signal 3.6e-11 43.5 23/27  
:HMM:PFM   148->170 PF12218 * End_N_terminal 2.1e-05 43.5 23/67  
:HMM:PFM   671->698 PF00746 * Gram_pos_anchor 4e-05 48.0 25/39  
:BLT:SWISS 1->708 PFBA_STRR6 0.0 99.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55753.1 GT:GENE ACF55753.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1656685..1658811) GB:FROM 1656685 GB:TO 1658811 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF55753.1 GB:DB_XREF GI:194357305 LENGTH 708 SQ:AASEQ MKYFVPNKVFSIRKLKVGTCSVLLAISILGSQGILSDEVVTSSSPMATKESSNAITNDLDNSPTVNQNRSAEMIASNSTTNGLDNSLSVNSISSNGTIRSNSQLDNRTVESTVTSTNENKSYKEDVISDRIIKKEFEDTALSVKDYGAVGDGIHDDRQAIQDAIDAAAQGLGGGNVYFPEGTYLVKEIVFLKSHTHLELNEKATILNGINIXNHPSIVFMTGLFTDDGAQVEWGPTEDISYSGGTIDMNGALNEEGTKAKNLPLINSSGAFAIGNSNNVTIKNVTFKDSYQGHAIQIAGSKNVLVDNSRFLGQALPKTMKDGQIISKESIQIEPLTRKGFPYALNDDGKKSENVTIQNSYFGKSDKSGELVTAIGTHYQTLSTQNPSNIKILNNHFDNMMYAGVRFTGFTDVLIKGNRFDKKVKGESVHYRENGAALVNAYSYKNTKDLLDLNKQVVIAENIFNIADPKTKAIRVAKDSAEYLGKVSDITVTKNVINNNSKETEQPNIELLRVSDNLVVSENSIFGGKEGIVIEDSKGKITVLNNQFYNLSGKYISFIKSNANGKEPVIRDSDGNFNIVTENGLYKIVTNNLSDKNEKEKNKEEKQSNSNNVIDSNQKNGEFNSSKDNRQMNDKIDNKQDNKREEVNYKIVGDGRETENHINKSKEIVDVKQKLPKTGSNKIMELFLTVTGIGLLLTLKGLKYYGKDK GT:EXON 1|1-708:0| SW:ID PFBA_STRR6 SW:DE RecName: Full=Plasmin and fibronectin-binding protein A;Flags: Precursor; SW:GN Name=pfbA; OrderedLocusNames=spr1652; SW:KW Cell wall; Coiled coil; Complete proteome; Peptidoglycan-anchor;Repeat; Secreted; Signal; Virulence. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->708|PFBA_STRR6|0.0|99.4|708/719| GO:SWS:NREP 3 GO:SWS GO:0005618|"GO:cell wall"|Cell wall| GO:SWS GO:0005576|"GO:extracellular region"|Secreted| GO:SWS GO:0009405|"GO:pathogenesis"|Virulence| SEG 153->169|ihddrqaiqdaidaaaq| SEG 590->611|nnlsdknekeknkeekqsnsnn| SEG 685->701|lfltvtgigllltlkgl| RP:PFM:NREP 1 RP:PFM:REP 465->552|PF01803|6e-04|31.0|84/332|LIM_bind| HM:PFM:NREP 3 HM:PFM:REP 8->30|PF04650|3.6e-11|43.5|23/27|YSIRK_signal| HM:PFM:REP 148->170|PF12218|2.1e-05|43.5|23/67|End_N_terminal| HM:PFM:REP 671->698|PF00746|4e-05|48.0|25/39|Gram_pos_anchor| GO:PFM:NREP 3 GO:PFM GO:0003712|"GO:transcription cofactor activity"|PF01803|IPR002691| GO:PFM GO:0005634|"GO:nucleus"|PF01803|IPR002691| GO:PFM GO:0007275|"GO:multicellular organismal development"|PF01803|IPR002691| RP:SCP:NREP 1 RP:SCP:REP 213->420|1jrgA|2e-11|25.1|195/354|b.80.1.1| HM:SCP:REP 139->570|1h80A_|4e-47|32.0|347/0|b.80.1.8|1/1|Pectin lyase-like| OP:NHOMO 36 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22--------------------11111111111111121111------------------------------------11111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,598-643,706-709| PSIPRED ccEEccccEEEcccEEEcccEEEEEEEEEEccccccEEEEEEccHHHHHHHHHHHHHHHccccccccccHHHEEEcccccHHHccccccccEEEcccEEEcccccccEEEEEEEEEccccccccccccccEEEEcccccEEEEEEcccccccccccHHHHHHHHHHHHHccccEEEEEcccEEEEcccEEEcccEEEEEccccEEEcccccccccccccccccccccccEEEEEccccEEEEEEEEEccccccccccccccEEccccccEEEEEccccEEEEEEEEEEcccccEEEEEEEEcEEEEEEEEEccccccccccccccccccEEEEEEEEccccccccccccccccEEEEccEEccccccEEEEEEEccccccccccccccEEEEccEEEccEEEEEEEccEEEEEEEEEEEEcccccEEEEEEccccEEEEEEEEEEEEEEEEccccEEEEcEEEccccccccccEEEEcccEEccEEccEEEEEEEEEccccccccccccEEEccccEEEEccEEcccccEEEEEEccccEEEEccEEEccccccEEEEEEcccccEEEEEEccccEEEEEEcEEEEEEcccEEEccccccccHHHcccccccccccccccccccccccHHHHHHHcccccccEEEEEEEEEEccccHHHHHcccHHHHHHHHHcccccccEEEEEEEEccccEEEEEEEccccccccc //