[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55756.1
DDBJ      :             phosphotyrosine protein phosphatase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  384/915 : Eukaryota  131/199 : Viruses  0/175   --->[See Alignment]
c.44.1
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->140 2gi4A PDBj 4e-23 40.6 %
:RPS:PDB   2->138 1d2aA PDBj 1e-35 32.6 %
:RPS:SCOP  2->138 1c0eA  c.44.1.1 * 4e-41 38.5 %
:HMM:SCOP  1->139 1d1qA_ c.44.1.1 * 1.8e-37 39.4 %
:RPS:PFM   3->135 PF01451 * LMWPc 8e-19 36.6 %
:HMM:PFM   2->136 PF01451 * LMWPc 6e-32 30.3 132/140  
:BLT:SWISS 1->142 PTPA_STAES 2e-26 42.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55756.1 GT:GENE ACF55756.1 GT:PRODUCT phosphotyrosine protein phosphatase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1844085..1844513) GB:FROM 1844085 GB:TO 1844513 GB:DIRECTION - GB:PRODUCT phosphotyrosine protein phosphatase GB:NOTE identified by match to protein family HMM PF01451 GB:PROTEIN_ID ACF55756.1 GB:DB_XREF GI:194357308 LENGTH 142 SQ:AASEQ MKKLVFVCLGNICRSPMAEFVMKSMTDXYEIQSRATSSWEHGNPIHKGTQGIFQEYEIPYDKNKTSLQISKEDFEAFDYIIGMDASNISDLRQMCPVDCQDKIYSFSSESVPDPWYTGDFEETYRRVQEGCQAWLERLEKES GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 1->142|PTPA_STAES|2e-26|42.8|138/154| BL:PDB:NREP 1 BL:PDB:REP 1->140|2gi4A|4e-23|40.6|138/156| RP:PDB:NREP 1 RP:PDB:REP 2->138|1d2aA|1e-35|32.6|135/156| RP:PFM:NREP 1 RP:PFM:REP 3->135|PF01451|8e-19|36.6|131/141|LMWPc| HM:PFM:NREP 1 HM:PFM:REP 2->136|PF01451|6e-32|30.3|132/140|LMWPc| GO:PFM:NREP 2 GO:PFM GO:0004725|"GO:protein tyrosine phosphatase activity"|PF01451|IPR017867| GO:PFM GO:0006470|"GO:protein amino acid dephosphorylation"|PF01451|IPR017867| RP:SCP:NREP 1 RP:SCP:REP 2->138|1c0eA|4e-41|38.5|135/154|c.44.1.1| HM:SCP:REP 1->139|1d1qA_|1.8e-37|39.4|137/0|c.44.1.1|1/1|Phosphotyrosine protein phosphatases I| OP:NHOMO 561 OP:NHOMOORG 515 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------1----1----------11-----1-11-1-11111---1-111-----1111-111---11111111-11------------------------1-11111---1-111---11111111111111--111111111111111---11---111111111111111111-1111111111111--12111111-11111111111111111111111--1-111--11--------11111111111111111111111111111111111111111111111-----------------------1-----11------------------1------------1--------------11--11111--1---1--11--111-111-1-----1-11---1---11---------11-1111------------------------------1-1-111111-11111111111111111111-111--------1-1--1--2----21-----1111111111--11-------------------------------1----111111-1--------1--------1111-11-11111111111-11-1--1----111-------------------------------------------------------------------------------------------------------1111---11-------11111111111111111111111111111---1111111111---12222211111111111111111111---1111-------------------------------1------------------1 ----11-----1111111--111--1---1111-111111111---1-111111--111111--1111111111-11-111111--11-12-11-1-----11111-1-1112-1221111-1121121232-2221-1---152-1-1-11241121122--11117224-111-1------1-1112-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 99.3 SQ:SECSTR cEEEEEEEcccccHHHHHHHHHHHHGGEEEEEEEEcccTTcTccccHHHHHHHHHTTcccccccccccccTTHHHHccEEEEccHHHHHHHHHHccTTcccEEEEGGGccccccTTccHHHHHHHHHHHHHHHHHHHHTTc# DISOP:02AL 142-143| PSIPRED ccEEEEEccccccccHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHccccccccccccccHHHHHHccEEEEccHHHHHHHHHHccHHHccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHc //