[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55761.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->103 PF02601 * Exonuc_VII_L 0.00017 15.6 90/319  
:BLT:SWISS 9->90 MTUS1_MOUSE 2e-04 32.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55761.1 GT:GENE ACF55761.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1180465..1180788) GB:FROM 1180465 GB:TO 1180788 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF55761.1 GB:DB_XREF GI:194357313 LENGTH 107 SQ:AASEQ MTNSVFSTMQDIENVATDIIKSYDNEIYTYKAVSQEELEKLEKSYDEKSHEELVSIESNLEMKQQNLIDEVNKTIKENDANIQYISSSRRGEFVEKIIGRVVEKYGH GT:EXON 1|1-107:0| BL:SWS:NREP 1 BL:SWS:REP 9->90|MTUS1_MOUSE|2e-04|32.9|82/1210| HM:PFM:NREP 1 HM:PFM:REP 10->103|PF02601|0.00017|15.6|90/319|Exonuc_VII_L| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--111-1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,39-48,106-108| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccEEEHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccHHHHHHHHHHHHHHHHHcc //