[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55769.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  904/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
c.37.1c.55.3
:148 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->143 3g60A PDBj 3e-33 49.3 %
:RPS:PDB   2->142 3b5jA PDBj 2e-28 51.1 %
:RPS:SCOP  3->126 1yvuA2  c.55.3.10 * 7e-24 14.5 %
:HMM:SCOP  20->144 1xmiA_ c.37.1.12 * 1.3e-31 35.2 %
:RPS:PFM   51->79 PF00005 * ABC_tran 4e-08 65.5 %
:RPS:PFM   51->117 PF02463 * SMC_N 7e-04 31.3 %
:HMM:PFM   5->79 PF00005 * ABC_tran 6e-16 40.0 65/118  
:BLT:SWISS 4->143 MDR1_RAT 2e-33 50.7 %
:PROS 51->65|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55769.1 GT:GENE ACF55769.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1168237..1168683) GB:FROM 1168237 GB:TO 1168683 GB:DIRECTION - GB:PRODUCT ABC transporter, ATP-binding protein GB:NOTE identified by match to protein family HMM PF00005 GB:PROTEIN_ID ACF55769.1 GB:DB_XREF GI:194357321 LENGTH 148 SQ:AASEQ MNRSILDNITLKHEVTSQKIEEVCKAVQIYDEIMAMPMKFNTIISEMGSNISGGQRQRIALARALINNPSIVILDEATSALDTINEERITKYIQSQGCTQIIVAHRLSTIKDADVIFVMKGGKIVESGNHKYLMDLGGEYYSLYTKRK GT:EXON 1|1-148:0| BL:SWS:NREP 1 BL:SWS:REP 4->143|MDR1_RAT|2e-33|50.7|140/1277| PROS 51->65|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 4->143|3g60A|3e-33|49.3|140/1182| RP:PDB:NREP 1 RP:PDB:REP 2->142|3b5jA|2e-28|51.1|141/243| RP:PFM:NREP 2 RP:PFM:REP 51->79|PF00005|4e-08|65.5|29/123|ABC_tran| RP:PFM:REP 51->117|PF02463|7e-04|31.3|67/536|SMC_N| HM:PFM:NREP 1 HM:PFM:REP 5->79|PF00005|6e-16|40.0|65/118|ABC_tran| GO:PFM:NREP 4 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| GO:PFM GO:0005524|"GO:ATP binding"|PF02463|IPR003395| GO:PFM GO:0005694|"GO:chromosome"|PF02463|IPR003395| RP:SCP:NREP 1 RP:SCP:REP 3->126|1yvuA2|7e-24|14.5|110/377|c.55.3.10| HM:SCP:REP 20->144|1xmiA_|1.3e-31|35.2|125/0|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 18158 OP:NHOMOORG 1170 OP:PATTERN 55336367775587863253334683388465433344443423395B21FC5378733465217111 9AH3VECBFFF8B575766-6933BK666668B999HOHM1IALGNH8HDC9ION57I33HK7BQ6HWTUBGFEENFEJBdI573455BD7727579--54G866G7D7E122222233244444B87CEB8FCBDCDDHH544L4RHJOHHD8A99C998B7CADJWdhF6E99886A897644933JD4AAKUVWUXUbYMXbZVVeYOPPPQYZaDBHWdMJLNOMONnfLIIIHIHFHIIIIHHEEDCKZRCNRROBPHVMLFFRUKEBDIMOMNOPSVRRQTUWPTRPLMRRLONJJJIJKLKLKKIKRSPLLLRRSOJSOSVRSRSTTQEYILMQQDMLKeHIUTJOK71lkNF65DB66GGMKAFKA45777879969A3XUcF9BKJHIEDHGJHGIHBFh-HHSHGOFRSaA3xggdcdWjggggVC568DFVLJMMFHKAAAAAAAAD68998AO332344445446447845664554575A5364634EKKEIHIJIKIEHIIFFFGQJJJJ8GEFRHAH93488ABDBB9GBMGLT8CD4B5BC85755656866BB6BBN7CBCE59B8773AAAA57B5A5465DF2F7459966666A5567667667857777IH7976B476K79AA897B9886889B79A3-64A95322222MHPPAJIGFFKGJJIFF-FFGEEFGEHGFIIDFGEEDQVVRVRQIGEGGGHHHHHHIHHGIPCBGEDEF95TQRRSROOQQSQ2292564458AB953I7LBA9DG99CBCBA89D899A96E78CFEBDDBIQLQCIKEE8TQR4444454344AEDMHHHHGKNLMO7A8677677844443389DD7788-11-11--s1J64448-833288733363D556212EDLCBJNGIF367 6755SOE-SB55NOMGEKHMOSPbPcOHHDEDEQSOEKKHKHGCCCPKOWUScVGIOGKFFGGEC89A3FA6EBFDD3DF8AA9GD69-RbCEIOKFEFKCBDKKC5Eze*SbRhWnIHGJKOHXaHrF**Z1jPnHJGDXFL*VFJIGDSFC*GQKNUJe*IhNEJnJT*cdnX9CCB*677ECccb*ImvCJuZfjL ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 148 STR:RPRED 100.0 SQ:SECSTR HTccHHHHHcTcTTccHHHHHHHHHHHTcHHHHHTcTTGGGccccTTTTcccHHHHHHHHHHHHHTTcccEEEEccccccccHHHHHHHHHHHHHTTcEEEEEcccGGGGTTccEEEEEETTEEEEEEcHHHHHHcTTcHHHHHHHHE DISOP:02AL 1-1,148-149| PSIPRED ccccHHHHHHccccccHHHHHHHHHHHcHHHHHHHccHHcccccccccccccHHHHHHHHHHHHHHHcccEEEEEHHHHHccHHHHHHHHHHHHHcccEEEEEEccHHHHHcccEEEEEEccEEEEEccHHHHHHcccHHHHHHHHcc //