[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55770.1
DDBJ      :             rhodanese-like domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  129/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.46.1
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   45->120 1gmxA PDBj 2e-06 28.4 %
:RPS:PDB   44->120 2eg3B PDBj 8e-15 23.7 %
:RPS:SCOP  28->120 1gmxA  c.46.1.3 * 5e-16 22.8 %
:HMM:SCOP  7->121 1c25A_ c.46.1.1 * 1.6e-24 34.8 %
:RPS:PFM   45->119 PF00581 * Rhodanese 4e-10 42.7 %
:HMM:PFM   33->121 PF00581 * Rhodanese 4.2e-18 34.8 89/113  
:HMM:PFM   3->21 PF09976 * DUF2133 0.0006 26.3 19/43  
:BLT:SWISS 20->112 YQHL_BACSU 3e-17 51.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55770.1 GT:GENE ACF55770.1 GT:PRODUCT rhodanese-like domain GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 613367..613747 GB:FROM 613367 GB:TO 613747 GB:DIRECTION + GB:PRODUCT rhodanese-like domain GB:NOTE identified by match to protein family HMM PF00581 GB:PROTEIN_ID ACF55770.1 GB:DB_XREF GI:194357322 LENGTH 126 SQ:AASEQ MVTWILWALILAMLAWMGFNYLRIRRAAKIVDNEEFEALIRTGQLIDLRDPAEFHRKHILGARNIPSSQLKTSLAALRKDKPVLLYENQRAQRVTNAALYLKKQGFSEIYILSYGLDSWKGKVKTS GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 20->112|YQHL_BACSU|3e-17|51.1|92/126| TM:NTM 1 TM:REGION 1->23| SEG 4->17|wilwalilamlawm| BL:PDB:NREP 1 BL:PDB:REP 45->120|1gmxA|2e-06|28.4|74/107| RP:PDB:NREP 1 RP:PDB:REP 44->120|2eg3B|8e-15|23.7|76/226| RP:PFM:NREP 1 RP:PFM:REP 45->119|PF00581|4e-10|42.7|75/108|Rhodanese| HM:PFM:NREP 2 HM:PFM:REP 33->121|PF00581|4.2e-18|34.8|89/113|Rhodanese| HM:PFM:REP 3->21|PF09976|0.0006|26.3|19/43|DUF2133| RP:SCP:NREP 1 RP:SCP:REP 28->120|1gmxA|5e-16|22.8|92/108|c.46.1.3| HM:SCP:REP 7->121|1c25A_|1.6e-24|34.8|115/0|c.46.1.1|1/1|Rhodanese/Cell cycle control phosphatase| OP:NHOMO 130 OP:NHOMOORG 129 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111211111111111111111--111111111111111111111111111111111111111111-1111111111111111111111111111111111111111---1111-------------------1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 79.4 SQ:SECSTR ########################cTTccEEcHHHHHTTTTcTEEEEcccHHHHHHcccTTcEEccccccccccHHTTccccEEEEccccccHHHHHHHHHHHHTTccEEEEccccGGGcHHHG## DISOP:02AL 122-127| PSIPRED cHHHHHHHHHHHHHHHHHHHcEEHHHHHccccHHHHHHHHcccEEEEcccHHHHHcccccccccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHcccccEEEEcccHHHHHHHcccc //