[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55774.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:150 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   60->96 PF01145 * Band_7 1.1e-06 38.9 36/179  
:HMM:PFM   8->34 PF08113 * CoxIIa 0.00081 54.2 24/34  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55774.1 GT:GENE ACF55774.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1958358..1958810 GB:FROM 1958358 GB:TO 1958810 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE contains potential frameshift GB:PROTEIN_ID ACF55774.1 GB:DB_XREF GI:194357326 LENGTH 150 SQ:AASEQ MTEKLINSKPNGVFALILIELTIVLGIFIFIMGVGSENIFGIIIGPLLIVIAGLAHAGLKVVKPQEALVLTLFGNYTGTIKEPGFYFVNPFSVAVNPANHTRLGQSGDVSTKSPFLGAKSSNDNDVNLEIGXETDFPQSHDLEQFSSKNQ GT:EXON 1|1-150:0| TM:NTM 2 TM:REGION 10->32| TM:REGION 38->60| HM:PFM:NREP 2 HM:PFM:REP 60->96|PF01145|1.1e-06|38.9|36/179|Band_7| HM:PFM:REP 8->34|PF08113|0.00081|54.2|24/34|CoxIIa| OP:NHOMO 17 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------11111111111-------------------------1-------------1---------1--1--------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,143-151| PSIPRED ccHHHcccccccEEEEEHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEccccEEEEEEEEEEEEEEEEccEEEEcHHHccccHHHHHccccccccccccccEEccccccccEEEEEcccccccccccHHHHHcccc //