[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55797.1
DDBJ      :             Amidohydrolase family protein
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  458/915 : Eukaryota  158/199 : Viruses  0/175   --->[See Alignment]
b.92.1c.1.9
:518 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   108->518 3h4uA PDBj 2e-45 32.6 %
:RPS:PDB   102->510 3e0lA PDBj 5e-52 21.3 %
:RPS:SCOP  100->184 1ymyA1  b.92.1.5 * 5e-14 16.2 %
:RPS:SCOP  158->454 1j6pA2  c.1.9.9 * 2e-77 32.1 %
:RPS:SCOP  434->507 2icsA1  b.92.1.8 * 1e-10 20.8 %
:HMM:SCOP  158->455 1j6pA2 c.1.9.9 * 4.2e-91 42.0 %
:RPS:PFM   284->470 PF01979 * Amidohydro_1 2e-13 37.8 %
:HMM:PFM   154->470 PF01979 * Amidohydro_1 2.2e-50 31.5 273/328  
:BLT:SWISS 108->517 MTAD_BACCN 2e-98 46.0 %
:REPEAT 3|25->39|40->54|55->69
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55797.1 GT:GENE ACF55797.1 GT:PRODUCT Amidohydrolase family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1260116..1261672) GB:FROM 1260116 GB:TO 1261672 GB:DIRECTION - GB:PRODUCT Amidohydrolase family protein GB:NOTE identified by match to protein family HMM PF01979; match to protein family HMM PF07969 GB:PROTEIN_ID ACF55797.1 GB:DB_XREF GI:194357349 LENGTH 518 SQ:AASEQ MKIKEQTRKLAVGCSKHSFEVVDKTDEVSSKHCFEVADRTDEVSSKHCFEVADRTDEVSSKHCFEVADRTDEVSNHTYGKVNLKWFEESTTCLLKKESIMKVFQHVNIVTCDQNFHVYLDGILAVKDSQIVYVGQDKPAFLEQAEQIIDYQGAWIMPGLVNCHTHSAMTGLRGIRDDSNLHEWLNDYIWPAESEFTPDMTTNAVKEALTEMLQSGTTTFNDMYNPNGVDIQQIYQVVKTSKMRCYFSPTLFSSETETTAETISRTRSIIDEILKYKNPNFKVMVAPHSPYSCSRDLLEASLEMAKELNIPLHVHVAETKEESGIILKRYGKRPLAFLEELGYLDHPSVFAHGVELNEREIERLASXQVAIAHNPISNLKLASGIAPIIQLQKAGVAVGIATDSVASNNNLDMFEEGRTAALLQKMKSGDASQFPIETALKVLTIEGAKALGMENQIGSLEVGKQADFLVIQPQGKIHLQPQENMLSHLVYAVKSSDVDDVYIAGEQVVKQGQVLTVEL GT:EXON 1|1-518:0| BL:SWS:NREP 1 BL:SWS:REP 108->517|MTAD_BACCN|2e-98|46.0|409/435| NREPEAT 1 REPEAT 3|25->39|40->54|55->69| SEG 252->269|ssetettaetisrtrsii| BL:PDB:NREP 1 BL:PDB:REP 108->518|3h4uA|2e-45|32.6|393/428| RP:PDB:NREP 1 RP:PDB:REP 102->510|3e0lA|5e-52|21.3|409/442| RP:PFM:NREP 1 RP:PFM:REP 284->470|PF01979|2e-13|37.8|148/271|Amidohydro_1| HM:PFM:NREP 1 HM:PFM:REP 154->470|PF01979|2.2e-50|31.5|273/328|Amidohydro_1| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01979|IPR006680| RP:SCP:NREP 3 RP:SCP:REP 100->184|1ymyA1|5e-14|16.2|80/85|b.92.1.5| RP:SCP:REP 158->454|1j6pA2|2e-77|32.1|280/281|c.1.9.9| RP:SCP:REP 434->507|2icsA1|1e-10|20.8|72/101|b.92.1.8| HM:SCP:REP 158->455|1j6pA2|4.2e-91|42.0|281/0|c.1.9.9|1/1|Metallo-dependent hydrolases| OP:NHOMO 1280 OP:NHOMOORG 672 OP:PATTERN --2-2-111111112111-----242232121111112222221111112121111122221111--- --213---------2---------12-----14---1342121321---11-311--1--1251213333---------122511111-----211---------11-----------------------------22211---2-1------11-----------1111-------------1211111-1--11111111111111133111-111---1---------42--------------------3-1----1-------11----------------1--119G1JSDMLP-------------1---------11113222121231316--111-2112-1--31111132122311111--111222--------434--------11111111111-423211341---33342125223541-11133----32133333333-111------------------------------------111-111-2223221----33422112125245532--22321---312122-41111122---------1221-22--123212112111111111111--222311111-1---111-------1-111112--1111-2---------2--------------1111-------1-23-22222222222-222222122222222222-232----1----------------2------11-111111111111---2111111111114-4---------------1111114-2-33444433643322433331---------2326-----1-11121111111111111--12--1111------------------1-----------------1233311111111 ----22--21--11111113232252411111-11111111111112223333412222222121-1-111111111-111-111111-14-1-2-111121-111-13111311121111-1-21-3-48112221-111-11--111-1112-1311----211111141-11123-5---2221222-11-5444- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 438 STR:RPRED 84.6 SQ:SECSTR ##############################################################################TcccccTTTccccc##GGGcccEEEEEEEEEcccccccEEEEEEEEcTTccEEEEEHHHHTTccGGGEEEccTTcEEEEcEEEEEEEGGGGGGTTccccccHHHHHHHTHHHHHHGGcHHHHHHHHHHHHHHHHHTTEEEEEEEccccHHHHHHHHHHHHHHTcEEEEEcEEcccccccTTccccHHHHHHHHHHHHTTccccEEEEEEEcccccHHHHHHHHHHHHHHTcEEEEEEcccHHHHHHHHHHccccHHHHHHTTTcccTTEEEEEcTTccHHHHHHHHHHTcEEEEcHHHHHHTTcccccHHHHHHTTcEEEEcccTTTcccHHHHHHHHHHHHHHHHHTTcccccccHHHHHHHHTHHHHHHTTcTTTcccccTTccccEEEEcTTTTTcccTTcEcHHHHHHHccTTTEEEEEETTEEEEcccHHHHHHH DISOP:02AL 1-6| PSIPRED ccHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccEEEEccEEEEEcccccEEEcEEEEEEccEEEEEccccccccccccEEEEccccEEEEcEEEccccHHHHHcccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHccccEEEEcEEEcccccccHHHHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHHcccEEEEEHHHcHHHHHHHHHHccccHHHHHHHcccccccEEEEEcccccHHHHHHHHHcccEEEEcHHHHHHHHcccccHHHHHHcccEEEEccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccccccccEEEEEccccccccccccHHHHHHHHcccccEEEEEEccEEEEEccEEEcccc //