[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55806.1
DDBJ      :             zinc ABC transporter, ATP-binding protein
Swiss-Prot:ADCC_STRR6   RecName: Full=Zinc transport system ATP-binding protein adcC;

Homologs  Archaea  68/68 : Bacteria  906/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:234 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   4->211 2nq2C PDBj 1e-24 31.5 %
:RPS:PDB   4->211 3b5jA PDBj 3e-35 25.7 %
:RPS:SCOP  4->211 1sgwA  c.37.1.12 * 3e-37 25.4 %
:HMM:SCOP  6->215 1ii8.1 c.37.1.12 * 4.5e-48 30.9 %
:RPS:PFM   43->166 PF00005 * ABC_tran 6e-11 35.0 %
:HMM:PFM   43->166 PF00005 * ABC_tran 8.9e-24 38.4 112/118  
:BLT:SWISS 1->234 ADCC_STRR6 e-138 99.6 %
:PROS 138->152|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55806.1 GT:GENE ACF55806.1 GT:PRODUCT zinc ABC transporter, ATP-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(2005724..2006428) GB:FROM 2005724 GB:TO 2006428 GB:DIRECTION - GB:PRODUCT zinc ABC transporter, ATP-binding protein GB:NOTE identified by match to protein family HMM PF00005 GB:PROTEIN_ID ACF55806.1 GB:DB_XREF GI:194357358 LENGTH 234 SQ:AASEQ MRYITVEDLSFYYDKEPVLEHINYCVDSGEFVTLTGENGAAXTTLIKASLGILQPRIGKVAISKTNTQGKKLRIAYLPQQIASFNAGFPSTVYEFVKSGRYPRKGWFRRLNAHDEEHIKASLDSVGMWEHRDKRLGSLSGGQKQRAVIARMFASDPDVFILDEPTTGMDAGSKNEFYELMHHSAHHHGKAVLMITHDPEEVKDYADRNIHLVRNQDSPWRCFNVHENGQEVGHA GT:EXON 1|1-234:0| SW:ID ADCC_STRR6 SW:DE RecName: Full=Zinc transport system ATP-binding protein adcC; SW:GN Name=adcC; OrderedLocusNames=spr1977; SW:KW ATP-binding; Competence; Complete proteome; Ion transport;Nucleotide-binding; Transport; Zinc; Zinc transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->234|ADCC_STRR6|e-138|99.6|234/234| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0030420|"GO:establishment of competence for transformation"|Competence| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| GO:SWS GO:0006829|"GO:zinc ion transport"|Zinc transport| PROS 138->152|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 4->211|2nq2C|1e-24|31.5|197/251| RP:PDB:NREP 1 RP:PDB:REP 4->211|3b5jA|3e-35|25.7|202/243| RP:PFM:NREP 1 RP:PFM:REP 43->166|PF00005|6e-11|35.0|120/123|ABC_tran| HM:PFM:NREP 1 HM:PFM:REP 43->166|PF00005|8.9e-24|38.4|112/118|ABC_tran| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 4->211|1sgwA|3e-37|25.4|193/200|c.37.1.12| HM:SCP:REP 6->215|1ii8.1|4.5e-48|30.9|204/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 32303 OP:NHOMOORG 1168 OP:PATTERN MMD6GBEELKLHKHNKYBFGDJFNlMQZWMXMC8BDDAGFFB9ORLQVIMzmX6MYIISKMGFAP166 JPY8*PRRYYYQRPOMNFF-FS88O*FEFFFGTZYaVw*xEUIYScURgTNEgecLFVAAUZZViZiv**NLJIIVPOQJiVW85B79POOH4M9C8--ADKEDHWGRFM77778779686666EMJBKMHFJJSKQZYleCDDjJXRUWUVWQRIIFAFCD9PROUnggIBHCDB8BKBDB7PNNHGXT7IYj***z*x**o***x***sppum***Tbi*zUfloqlkk**QWWYXYWVXXVVWXXRYUXWoYSUjhSLVSafeLMloLPIObUSZXhfihdblhkkdfddbadfbdeSTSSSSTSUTSSTmffTTWhgiaZ*kxuxzx**xybvZjxjjUcca*eXdgmXhOG**aXQTcTPRYRaYFPWSGWTLLGEGGDDUK***OHcuiirlptooqkrnnl*-WbwYUzWlw*MA*************xCEIei*pjqv*ft99999999SGJDDbQf55556444424456785455454466574BA5C8Df**ejoz*z*wfcZbY****haeeSgxt*dklg7EaZUdOYQSlhwr**JXUFM9FPMFFFDEFEJHINPQSm*MTQZVTWdQQXBUONOOOSMLMMIJYeThIFKKBFFGHFB5A6566666AMDDBGFaZjJaNRJPFfLKNQLHHSOLLLGNRPNMU5-AHKII-1-111tg*vQufgkjghhdiff-iffhhdghghjigddfdcby*x**QPRabYYaaaaaaYZaYYWwbaUdddeI2stuwxwvutxxz33EEBCABAGGGFGFre*TTRQQNBLNKKNIMZKNONNEPBHQUPVWUTbjX*cdidZQpw*888789888HYbcrdfeefgmgddEEHDDDDDDF866666EPHHGHFF65444443s9N8765C-68B6B86FEB8BC856777NSeHOXnYbb9NJ -1--FA9-IC47CFD878658A77579AA4545A98496766656655888AE94883596931144321631433414343322312-8967734332451984248CCKDIHVGKC7A6BKHYY5f7z*S3OLREH86U8EbO6D588R64*8OKFXDW*8XFS7bKP*KPJG6877*99B53UCEZ4SK77SJQN6 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 234-235| PSIPRED ccEEEEEEEEEEEccEEEEEEEEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEHHHHHHHcEEEccccccccccccccHHHHHHcccHHHHcccccccHHHHHHHHHHHHHcccHHHHcccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEcccccHHHHHccHHHHHHHccc //