[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55809.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:45 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55809.1 GT:GENE ACF55809.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 416949..417086 GB:FROM 416949 GB:TO 417086 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55809.1 GB:DB_XREF GI:194357361 LENGTH 45 SQ:AASEQ MLLTSSVLSTTSKQCFEQPAASFLVCSLIFIEYKENCKNKNGDFI GT:EXON 1|1-45:0| TM:NTM 1 TM:REGION 13->34| SEG 2->12|lltssvlstts| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,39-46| PSIPRED ccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccc //