[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55811.1
DDBJ      :             choline-binding protein F, point mutation
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  2/199 : Viruses  4/175   --->[See Alignment]
b.109.1
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->159 2v04A PDBj 2e-70 69.6 %
:RPS:PDB   40->157 1e88A PDBj 2e-11 14.3 %
:RPS:SCOP  28->158 2bibA1  b.109.1.1 * 2e-27 41.4 %
:HMM:SCOP  4->158 2bibA1 b.109.1.1 * 1.4e-47 48.9 %
:HMM:PFM   40->58 PF01473 * CW_binding_1 5.4e-07 47.4 19/19  
:HMM:PFM   60->79 PF01473 * CW_binding_1 3.2e-07 47.4 19/19  
:HMM:PFM   81->99 PF01473 * CW_binding_1 1.1e-09 47.4 19/19  
:HMM:PFM   101->120 PF01473 * CW_binding_1 1.9e-07 47.4 19/19  
:HMM:PFM   122->139 PF01473 * CW_binding_1 9.3e-09 55.6 18/19  
:BLT:SWISS 13->143 LYS_BPCP1 4e-24 37.7 %
:REPEAT 6|4->33|35->54|55->74|76->95|96->115|116->135

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55811.1 GT:GENE ACF55811.1 GT:PRODUCT choline-binding protein F, point mutation GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 350094..350573 GB:FROM 350094 GB:TO 350573 GB:DIRECTION + GB:PRODUCT choline-binding protein F, point mutation GB:NOTE identified by match to protein family HMM PF01473 GB:PROTEIN_ID ACF55811.1 GB:DB_XREF GI:194357363 LENGTH 159 SQ:AASEQ MAVGELARGWVKDSPLTYDEEKLKAAPWYYLDPTTGIMQTGWQFLGNRWYYLHSSGAMATGWYKEGSTWYYLDAENGDMRTGWQYLGNKWYYLRSSGAMATGWYQEGSTWYYLNASNGDMKTGWFQVNGNWYYAYDSGALAVNTTVGGYYLNYNGEWVK GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 13->143|LYS_BPCP1|4e-24|37.7|130/339| NREPEAT 1 REPEAT 6|4->33|35->54|55->74|76->95|96->115|116->135| BL:PDB:NREP 1 BL:PDB:REP 1->159|2v04A|2e-70|69.6|158/311| RP:PDB:NREP 1 RP:PDB:REP 40->157|1e88A|2e-11|14.3|112/160| HM:PFM:NREP 5 HM:PFM:REP 40->58|PF01473|5.4e-07|47.4|19/19|CW_binding_1| HM:PFM:REP 60->79|PF01473|3.2e-07|47.4|19/19|CW_binding_1| HM:PFM:REP 81->99|PF01473|1.1e-09|47.4|19/19|CW_binding_1| HM:PFM:REP 101->120|PF01473|1.9e-07|47.4|19/19|CW_binding_1| HM:PFM:REP 122->139|PF01473|9.3e-09|55.6|18/19|CW_binding_1| RP:SCP:NREP 1 RP:SCP:REP 28->158|2bibA1|2e-27|41.4|128/232|b.109.1.1| HM:SCP:REP 4->158|2bibA1|1.4e-47|48.9|141/0|b.109.1.1|1/1|Cell wall binding repeat| OP:NHOMO 336 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------36-M-----------------------------------------------------------------------------------------------------------------------1---------------1------1----------------------------1-----------------5----2---------3--ECCFEEEBDFB--------------------------1p-------X-Z-2---564-------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------1------------------------- ---------------1---------------------------------------------------------1---------------------------------------------------1-1----------------------------------------------- STR:NPRED 159 STR:RPRED 100.0 SQ:SECSTR EEEEccccHHHHccccccccEEEEEEEEEETTEEEEEEEccEEccccccccGGGTcccccccEEETTEEEcccccEEEcccccccccccEEEccccHHHHccETTccccccEEETcTTccccccEEETTEEEcccccTTcccccEEccTcHHHHccEcc DISOP:02AL 1-1| PSIPRED ccccccEEEEEEcccEEEccEEEEccEEEEEEccccEEEEEEEEEccEEEEEcccccEEEEEEEEccEEEEEEccccEEEEEEEEEccEEEEEcccccEEEEEEEEccEEEEEEccccEEEEEEEEEccEEEEEcccccEEEEEEEccEEEcccccccc //