[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55815.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  63/68 : Bacteria  891/915 : Eukaryota  196/199 : Viruses  1/175   --->[See Alignment]
b.40.4c.37.1e.26.1
:633 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   12->396,444->519 2ix3A PDBj 5e-27 36.3 %
:RPS:PDB   9->573 3cmvA PDBj 6e-47 10.8 %
:RPS:SCOP  2->57 2vnuD1  b.40.4.5 * 3e-09 3.6 %
:RPS:SCOP  34->573 1mjgM  e.26.1.3 * 7e-32 10.5 %
:HMM:SCOP  9->237 1ii8.1 c.37.1.12 * 1.5e-43 26.4 %
:HMM:SCOP  291->533 1r0wA_ c.37.1.12 * 2.9e-38 23.7 %
:RPS:PFM   162->191 PF00005 * ABC_tran 5e-07 56.7 %
:HMM:PFM   43->191 PF00005 * ABC_tran 1.6e-21 38.3 107/118  
:HMM:PFM   367->472 PF00005 * ABC_tran 1.4e-13 29.8 104/118  
:HMM:PFM   19->64 PF03193 * DUF258 3.4e-05 24.4 45/161  
:HMM:PFM   342->373 PF01580 * FtsK_SpoIIIE 8.1e-05 37.5 32/205  
:HMM:PFM   533->610 PF05667 * DUF812 7.6e-06 24.7 73/594  
:HMM:PFM   223->278 PF09140 * MipZ 0.00069 30.4 56/261  
:BLT:SWISS 1->528 YDIF_BACSU e-155 53.0 %
:PROS 444->458|PS00211|ABC_TRANSPORTER_1
:COIL
:REPEAT 2|2->275|325->558
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55815.1 GT:GENE ACF55815.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 987922..989823 GB:FROM 987922 GB:TO 989823 GB:DIRECTION + GB:PRODUCT ABC transporter, ATP-binding protein GB:NOTE identified by match to protein family HMM PF00005 GB:PROTEIN_ID ACF55815.1 GB:DB_XREF GI:194357367 LENGTH 633 SQ:AASEQ MIILQANKIERSFAGEVLFDNINLQVDERDRIALVGKNGAGKSTLLXILVGXEEPTSGXINKKKDISLSYLAQDSRFESENTIYDEMLHVFNNLRRTERQLRQMELEMGEKSGEDLDKLMSDYDRLSENFRQAGGFTYEADIRAILNGFKFDESMWQMKIAELSGGQNTRLALAKMLLEKPNLLVLDEPTNHLDIETIAWLENYLVNYSGALIIVSHDRYFLDKVATITLDLTKHSLDRYVGNYSRFVELKEQKLVTEAKNYEKQQKEIAALEDFVNRNLVRASTTKRAQSRRKQLEKMERLDKPEAGKKAANMTFQSEKTSGNVVLTVENTAIGYDGEVLSQPINLDLRKMNAVAIVGPNGIGKSTFIKSIVDQIPFIKGEKRFGANVEVGYYDQTQSKLTPSNTVLDELWNDFKLTPEVEIRNRLGAFLFSGDDVKKSVGMLSGGEKARLLLAKLSMENNNFLILDEPTNHLDIDSKEVLENALIDFDGTLLFVSHDRYFINRVATHVLELSENGSTLYLGDYDYYVEKKATAEMSQTEEASTSNQAKEASPVNDYQAQKESQKEVRKLMRQIESLEAEIEELESQSQAISEQMLETNDADKLMELQAELDKISHRQEEAMLEWEELSDQV GT:EXON 1|1-633:0| BL:SWS:NREP 1 BL:SWS:REP 1->528|YDIF_BACSU|e-155|53.0|528/642| PROS 444->458|PS00211|ABC_TRANSPORTER_1|PDOC00185| COIL:NAA 78 COIL:NSEG 1 COIL:REGION 556->633| NREPEAT 1 REPEAT 2|2->275|325->558| SEG 574->595|qiesleaeieelesqsqaiseq| BL:PDB:NREP 1 BL:PDB:REP 12->396,444->519|2ix3A|5e-27|36.3|371/972| RP:PDB:NREP 1 RP:PDB:REP 9->573|3cmvA|6e-47|10.8|558/1190| RP:PFM:NREP 1 RP:PFM:REP 162->191|PF00005|5e-07|56.7|30/123|ABC_tran| HM:PFM:NREP 6 HM:PFM:REP 43->191|PF00005|1.6e-21|38.3|107/118|ABC_tran| HM:PFM:REP 367->472|PF00005|1.4e-13|29.8|104/118|ABC_tran| HM:PFM:REP 19->64|PF03193|3.4e-05|24.4|45/161|DUF258| HM:PFM:REP 342->373|PF01580|8.1e-05|37.5|32/205|FtsK_SpoIIIE| HM:PFM:REP 533->610|PF05667|7.6e-06|24.7|73/594|DUF812| HM:PFM:REP 223->278|PF09140|0.00069|30.4|56/261|MipZ| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 2 RP:SCP:REP 2->57|2vnuD1|3e-09|3.6|56/95|b.40.4.5| RP:SCP:REP 34->573|1mjgM|7e-32|10.5|522/728|e.26.1.3| HM:SCP:REP 9->237|1ii8.1|1.5e-43|26.4|227/370|c.37.1.12|1/2|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 291->533|1r0wA_|2.9e-38|23.7|241/0|c.37.1.12|2/2|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 7582 OP:NHOMOORG 1151 OP:PATTERN 2223-125323322873111-2158227654334412-323211432173984224222432224--3 5591A679AAA67464533-35227733333455559897154688557454A7B584117764A788AA734448559444114143668726552-146C888679371211112121222254325544344543363123918532456-233222323451463A6334354652354537--92334BHHJHIEFIAHKHFHKA9AAA7HIG359LF9CB99A98GKA777576666777669A8B69C7AA995BBI88447A7888E7999889CCCED9AFCCDBCDEEEE6666767766666DAA997AAAC6IBDOIIIIJKKGICAO888EBCLE4EJ27C42JJA724651189654A872535552353375FAA447A8BD68865868867F-46854B478F52HDD9DBEEGFJE8635466755446B87777777765556456----1111--223244134222441211-1344357653578897856666559766666676D758815987535558575A95584443556664665453766A9E4747454C334295976777867567645A35847886432234333336943555999896878AA6667668788885796796--3335311-222A7AA8A78996867678-A888966889A69778779CBDAA58B5865666666666655988977785-97999CB99899113612111575744B5D997766576468455767563555686AA8A8A9A8788A58993122333316AA9I88889BDDDC54443444433333335677666632212112C1511-22-224413-9B8263242--163A6739522-42 1211447-733155865657767867555555576555446444555665675A5565554544545444445665535545555455-5655556444554599C14T65554958334333233483XW5-64722133334625331421B393474AT39544535D58563ACG*FCF6794BG5A6EFB779H ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--- DISOP:02AL 278-306,534-599| PSIPRED cEEEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHcccccccccEEEEccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccEEEcccccccccEEEEEEccEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEcccEEEEEEcccHHHccccccHHHHHHHHcccccHHHHHHHHHHccccHHHHHccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEcccHHHHHHHccEEEEEEccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //