[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55820.1
DDBJ      :             PTS system, IIA component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  209/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.7.2
:106 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->103 1wcrA PDBj 2e-14 37.1 %
:RPS:PDB   7->103 2e2aA PDBj 1e-29 32.0 %
:RPS:SCOP  7->101 1e2aA  a.7.2.1 * 6e-29 33.7 %
:HMM:SCOP  1->102 1e2aA_ a.7.2.1 * 2.4e-32 44.1 %
:RPS:PFM   7->101 PF02255 * PTS_IIA 1e-15 49.5 %
:HMM:PFM   8->102 PF02255 * PTS_IIA 1.1e-38 47.4 95/96  
:BLT:SWISS 7->103 PTJA_BACSU 1e-16 39.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55820.1 GT:GENE ACF55820.1 GT:PRODUCT PTS system, IIA component GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 217508..217828 GB:FROM 217508 GB:TO 217828 GB:DIRECTION + GB:PRODUCT PTS system, IIA component GB:NOTE identified by match to protein family HMM PF02255 GB:PROTEIN_ID ACF55820.1 GB:DB_XREF GI:194357372 LENGTH 106 SQ:AASEQ MEIIVPDQIIMGLILYAGDAKQHIYKALDYIKNGTCERCEEEIQLADAALLEAHNLQTKFLAQEASGTKTEITALFVHSQDHLMTSMTEINLIKEIISLRKELHKK GT:EXON 1|1-106:0| BL:SWS:NREP 1 BL:SWS:REP 7->103|PTJA_BACSU|1e-16|39.2|97/110| TM:NTM 1 TM:REGION 1->23| BL:PDB:NREP 1 BL:PDB:REP 7->103|1wcrA|2e-14|37.1|97/103| RP:PDB:NREP 1 RP:PDB:REP 7->103|2e2aA|1e-29|32.0|97/104| RP:PFM:NREP 1 RP:PFM:REP 7->101|PF02255|1e-15|49.5|95/96|PTS_IIA| HM:PFM:NREP 1 HM:PFM:REP 8->102|PF02255|1.1e-38|47.4|95/96|PTS_IIA| GO:PFM:NREP 4 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF02255|IPR003188| GO:PFM GO:0006810|"GO:transport"|PF02255|IPR003188| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF02255|IPR003188| GO:PFM GO:0016020|"GO:membrane"|PF02255|IPR003188| RP:SCP:NREP 1 RP:SCP:REP 7->101|1e2aA|6e-29|33.7|95/102|a.7.2.1| HM:SCP:REP 1->102|1e2aA_|2.4e-32|44.1|102/0|a.7.2.1|1/1|Enzyme IIa from lactose specific PTS, IIa-lac| OP:NHOMO 429 OP:NHOMOORG 209 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------2333333332323233322222333-1212-36564441----------------1--1111--46--3-122--561-2123-1-1122434322444444534333333333333333123---4332-2-291111111211-4---111--------------------111---2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------13----------------------------------------12-1-2-1112121221-1112211222121111112343331111111111111111111----1111--3111111-1111------------------------------------------------------------------------21121111111--------------------1------111-1-------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 94.3 SQ:SECSTR ######HHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTc DISOP:02AL 1-3,105-107| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //