[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55828.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:200 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   110->157 PF10561 * UPF0565 6.2e-05 25.0 48/302  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55828.1 GT:GENE ACF55828.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1046986..1047588) GB:FROM 1046986 GB:TO 1047588 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55828.1 GB:DB_XREF GI:194357380 LENGTH 200 SQ:AASEQ MSEVDFNEAVNYEFTSDTCQLANSIYQSLFKFFDKKNFSGDLIFTWKSPSLVKERDYIGRRDSQVDNLRVXGNIFLNYLTNRKYSLNMNRNGCMGDFPHDFFDIYLDHVAKYAYEQKVNNIKEYYPLKRAILHQENALYFRFFSNFDDFLEKNYLKTIWQVSKETPFSEMDFNMFKNISEKIIFERGSKMLNDLKSNYKK GT:EXON 1|1-200:0| HM:PFM:NREP 1 HM:PFM:REP 110->157|PF10561|6.2e-05|25.0|48/302|UPF0565| OP:NHOMO 11 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-11121--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,195-201| PSIPRED cccccHHHccccEEccHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHccccccccccccccccEEEEccHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccEEEHEHHccHHHHHHHHHHHHHHHHHccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //