[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55829.1
DDBJ      :             inosine-5'-monophosphate dehydrogenase
Swiss-Prot:IMDH_STRPY   RecName: Full=Inosine-5'-monophosphate dehydrogenase;         Short=IMP dehydrogenase;         Short=IMPDH;         Short=IMPD;         EC=1.1.1.205;

Homologs  Archaea  43/68 : Bacteria  857/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
c.1.5
:492 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->491 1zfjA PDBj 0.0 89.8 %
:RPS:PDB   7->83 2cu0B PDBj 1e-08 59.7 %
:RPS:PDB   68->491 3bg3B PDBj 1e-58 15.4 %
:RPS:SCOP  13->91 1ak5A1  c.1.5.1 * 1e-22 38.6 %
:RPS:SCOP  146->473 1ak5A1  c.1.5.1 * 3e-74 29.3 %
:HMM:SCOP  5->484 1pvnA1 c.1.5.1 * 4.6e-133 55.2 %
:RPS:PFM   11->477 PF00478 * IMPDH e-163 67.0 %
:HMM:PFM   11->479 PF00478 * IMPDH 3.1e-150 58.9 348/351  
:BLT:SWISS 1->492 IMDH_STRPY 0.0 90.4 %
:PROS 300->312|PS00487|IMP_DH_GMP_RED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55829.1 GT:GENE ACF55829.1 GT:PRODUCT inosine-5'-monophosphate dehydrogenase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(2064082..2065560) GB:FROM 2064082 GB:TO 2065560 GB:DIRECTION - GB:PRODUCT inosine-5'-monophosphate dehydrogenase GB:NOTE identified by match to protein family HMM PF00478; match to protein family HMM PF00571; match to protein family HMM TIGR01302 GB:PROTEIN_ID ACF55829.1 GB:DB_XREF GI:194357381 LENGTH 492 SQ:AASEQ MSNWDTKFLKKGFTFDDVLLIPAESHVLPNDADLTTKLADNLTLNIPIITAAMDTVTESQMAIAIARAGGLGVIHKNMSIAQQADXVRKVKRSENGVIIDPFFLTPEHTIAEADELMGRYRISGVPVVETLENRKLVGILTNRXLRFISDYNQPISNHMTSENLVTAPVGTDLATAESILQEHRIEKLPLVDEEGSLSGLITIKDIEKVIEFPNAAKDEFGRLLVAGAVGVTSDTFERAEALFEAGADAIVIDTAHGHSAGVLRKIAEIRAHFPDRTLIAGNIATAEGARALYEAGVDVVKVGIGPGSICTTRVIAGVGVPQVTAIYDAAAVAREYGKTIIADGGIKYSGDIVKALAAGGNAVMLGSMFAGTDEAPGETEIFQGRKFKTYRGMGSIAAMKKGSSDRYFQGSVNEANKLVPEGIEGRVAYKGAAADIVFQMIGGIRSGMGYCGAANLKELHDNAQFIEMSGAGLKESHPHDVQITNEAPNYSM GT:EXON 1|1-492:0| SW:ID IMDH_STRPY SW:DE RecName: Full=Inosine-5'-monophosphate dehydrogenase; Short=IMP dehydrogenase; Short=IMPDH; Short=IMPD; EC=1.1.1.205; SW:GN Name=guaB; Synonyms=impD; SW:KW 3D-structure; CBS domain; GMP biosynthesis; Metal-binding; NAD;Oxidoreductase; Potassium; Purine biosynthesis; Repeat. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->492|IMDH_STRPY|0.0|90.4|492/493| GO:SWS:NREP 5 GO:SWS GO:0006177|"GO:GMP biosynthetic process"|GMP biosynthesis| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006164|"GO:purine nucleotide biosynthetic process"|Purine biosynthesis| PROS 300->312|PS00487|IMP_DH_GMP_RED|PDOC00391| BL:PDB:NREP 1 BL:PDB:REP 2->491|1zfjA|0.0|89.8|463/463| RP:PDB:NREP 2 RP:PDB:REP 7->83|2cu0B|1e-08|59.7|77/355| RP:PDB:REP 68->491|3bg3B|1e-58|15.4|415/603| RP:PFM:NREP 1 RP:PFM:REP 11->477|PF00478|e-163|67.0|458/459|IMPDH| HM:PFM:NREP 1 HM:PFM:REP 11->479|PF00478|3.1e-150|58.9|348/351|IMPDH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00478|IPR001093| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00478|IPR001093| RP:SCP:NREP 2 RP:SCP:REP 13->91|1ak5A1|1e-22|38.6|79/329|c.1.5.1| RP:SCP:REP 146->473|1ak5A1|3e-74|29.3|294/329|c.1.5.1| HM:SCP:REP 5->484|1pvnA1|4.6e-133|55.2|344/0|c.1.5.1|1/1|Inosine monophosphate dehydrogenase (IMPDH)| OP:NHOMO 1781 OP:NHOMOORG 1092 OP:PATTERN 11--------------111-----211112221111111111111111-----111111111111-11 1111311222212122222-2222222222222222222321212222132221332322222323322332111222111111111122111211---212111111111-------11-112-111111111111111111111111111-1111111111111111111111111111111111111211222222222222222221221222211122222222222112222222222222122222222222212322122222222222222222222211222222222222222222222222122111222211122111111111111111111111111111111111121211111111111111111111111111112122211111111111-11111111111111111111111111111111111111111111111111111121111111111---------------111111111111111111111111111111111111111111111111212222222222221111211111111111111211111111111111222111111222212111111111111111222222211111112221111111111111112111111211111-1111111-11122222222222222222-222222222222222222222222111222222222222222222222222112222222222221111111112222111111111111121111111111111111111111211111111111111111111112222222222222211111111111111111111111111111-1-1-1----2------------12------1111111111111 1111112-522-1111111-11111111111111111111111111111111111111111112111111112-13347511112211-11111111111111212-12148656864444444453E4Op9-86C3443644442432443394424424A32222311323321111I1111121231211143432 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 492 STR:RPRED 100.0 SQ:SECSTR ccHHHHHcccccccTTcEEEccccccccGGGccccEEcccccEEcccEEEcccTTTccTHHHHHHHHccHHHHHHHHHcHHHHHHHHHHccccETTcEEEcTTTHHHHcHHHHHHTHHHHHHHcTTccEEGEEEETTHHHHHHHTccccHHHHHHHHHHHcccEEcGGGTTccccccHHHHHHHHHHHHTTTccEEEccTTccHHHHHHHHEEEEEEccccTTcTTcccccHHHHHHHHHHHHHHTccEEEEETTccccHHHHHHHHHHHTTcTTccTTccHHHHHHcEEHHHHTTccEEEEccTTccccHHHHHHcccHHHHHHHHHHHHHHHHTTGGGcGGGTccccHHHHHTTTTcccTTTccccHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHTTcccHHHHcTTTTcccHHHHHHHTTTccTTcccHHHHHHHHTTcccccccHHHHcccccHHHHHHHHHHHcccHcccHHHHHHHHHcHHHHc DISOP:02AL 1-2,4-4,400-401,491-493| PSIPRED cccccccHHHHcccccEEEEcccccccccccEEEEEEEEcccEEEccEEEccccccccHHHHHHHHHcccccEEcccccHHHHHHHHHHEEEccccEEEEEEEEccHHHHHHHHHHHHHccccEEEEEEcccccEEEEEEEHHHHHHcccccccHHHHccccccEEEcccccHHHHHHHHHHccccEEEEEEccccEEEEEEEEcHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccccHHHccHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHccccEEEEcccccccccHHHHHcccccHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccccEEEEccHHHccccccccEEEEccEEEcccccccHHHHHHccccHHcccccccccccccccccEEEEEccccHHHHHHHHHHHHHHHHHHcccccHHHHHHccEEEEEcHHHHHccccccEEEEEccccccc //