[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55833.1
DDBJ      :             ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  28/68 : Bacteria  692/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:219 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   110->150 3dhwA PDBj 4e-09 32.4 %
:RPS:SCOP  39->214 2r6gG1  f.58.1.1 * 5e-16 14.3 %
:HMM:PFM   35->214 PF00528 * BPD_transp_1 9.9e-22 18.8 176/185  
:BLT:SWISS 11->213 GLNP_BACSU 1e-24 39.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55833.1 GT:GENE ACF55833.1 GT:PRODUCT ABC transporter, permease protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(535830..536489) GB:FROM 535830 GB:TO 536489 GB:DIRECTION - GB:PRODUCT ABC transporter, permease protein GB:NOTE identified by match to protein family HMM PF00528; match to protein family HMM TIGR01726 GB:PROTEIN_ID ACF55833.1 GB:DB_XREF GI:194357385 LENGTH 219 SQ:AASEQ MESILEVLTPDNLVFIFKGFGLTLYISLIAIILSTIIGTVLAVMRNGKNPVLRIISSIYIEFVRNVPNLLWIFTIFLVFKMKSTPAGITAFTLFTSAALAEIIRGGLNAVDKGQYEAGMSQGFTSAQILYYIILPQAIRKMLPAIISQFVTVIKDTSLLYSVIALQELFGASQILMGRYFEPEQVFSLYILIALIYFSFNLAISSLSHMLAKRWQQAAE GT:EXON 1|1-219:0| BL:SWS:NREP 1 BL:SWS:REP 11->213|GLNP_BACSU|1e-24|39.6|202/218| TM:NTM 5 TM:REGION 21->43| TM:REGION 69->91| TM:REGION 127->149| TM:REGION 157->179| TM:REGION 186->208| SEG 22->37|ltlyisliaiilstii| SEG 89->100|taftlftsaala| RP:PDB:NREP 1 RP:PDB:REP 110->150|3dhwA|4e-09|32.4|37/203| HM:PFM:NREP 1 HM:PFM:REP 35->214|PF00528|9.9e-22|18.8|176/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 39->214|2r6gG1|5e-16|14.3|175/284|f.58.1.1| OP:NHOMO 3581 OP:NHOMOORG 723 OP:PATTERN ----12----------1-1111112--11-2211----1122--1112--1-1----2------1--- ----421122222-311----5--18------544425B913223161333-658114--112-37583A2644454421411---------------------------11111111111111-----1--4---222331111-12342233322-11-1--1--3322-1111--1111-1341111--25455555875566556623396556332544355555396222222222222222222246757AA875676655993757B533388895665AA999888999986666566666666768BA9888812547564545523234332333312214223199-4132-1111111171--11125333311I58112311122365346555O-22B22A17BF12ePPHLLNOOYFJK8---13E44561471111111132411-36----------111111111111111--1-4--2--4FDAEDFFEFC7577788EI888867B9O66831287B7485488GCIM243----733322222---24-11I-896B45A99842-23-3----------4-4441666663232221121-12----766-1-----6-1111--11111111-11-2---1--------77FB4886666664665-6686666666666566556CGBHG5645544555555555555B55566662-788888778888--2-111111111--55944442422212222-55555-41222-A9AACFHM8AE9A4JGI----------5446888888986611---------------2----------------32-4----------------------122-115111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------6-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 37 STR:RPRED 16.9 SQ:SECSTR #############################################################################################################ccTTTTTHHHHHTccTHHHHHHTTHHHH####HHHHHHHHH##################################################################### DISOP:02AL 1-1,215-220| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //