[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55837.1
DDBJ      :             IS66-Spn1, transposase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  158/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   10->100 PF05717 * Transposase_34 6e-25 49.5 %
:HMM:PFM   10->104 PF05717 * Transposase_34 2.8e-39 45.3 95/108  
:BLT:SWISS 10->100 Y4HO_RHISN 2e-12 35.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55837.1 GT:GENE ACF55837.1 GT:PRODUCT IS66-Spn1, transposase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(2050686..2051009) GB:FROM 2050686 GB:TO 2051009 GB:DIRECTION - GB:PRODUCT IS66-Spn1, transposase GB:NOTE identified by match to protein family HMM PF05717 GB:PROTEIN_ID ACF55837.1 GB:DB_XREF GI:194357389 LENGTH 107 SQ:AASEQ MIIQLSDLGQVHLVCGKTDMRQGIDSLAYVVKTHFELDPFSDQVFLFCGGRKDRFKVLYWDGQGFWILYKRFENGKLTWSSTEKDVKALTSEQVDWLMKGFSITPQI GT:EXON 1|1-107:0| BL:SWS:NREP 1 BL:SWS:REP 10->100|Y4HO_RHISN|2e-12|35.2|91/115| RP:PFM:NREP 1 RP:PFM:REP 10->100|PF05717|6e-25|49.5|91/105|Transposase_34| HM:PFM:NREP 1 HM:PFM:REP 10->104|PF05717|2.8e-39|45.3|95/108|Transposase_34| OP:NHOMO 787 OP:NHOMOORG 158 OP:PATTERN -------------------------------------------------------------------- --3----------------------------------------------------------------------------------------3---------------------------------------------------------------------------------------------------2-----------------------------------------------------------------44---2---551--------------------131331512431----1--------11---111--2-------------4---------1----2-21-1-23---1----------2----------7253---1--51-111111118---1--3---1--3--97-344-3416-----31424---656666661----4----------------------------------2------3--24--7----1123121--A1B9-321----------221-1---1----------------A1--B5--2---C----------------1------------------------------34---------1--111-------31----------2----------------CD7-222H1-D--1115--6D34--------1---5--1---------------9c37163----------------------------------------------------------9-------1-63---e------------*--E-----x--------------------F-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cEEccccccEEEEEcccEEccccHHHHHHHHHHHHccccccccEEEEEcccccEEEEEEEEcccEEEEEEHHHccccccccccccEEEEcHHHHHHHHccccccccc //