[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55854.1
DDBJ      :             NOL1/NOP2/sun family protein
Swiss-Prot:             

Homologs  Archaea  51/68 : Bacteria  696/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:434 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->291 2frxB PDBj 3e-38 37.5 %
:RPS:PDB   91->289 2c7oA PDBj 1e-24 14.6 %
:RPS:SCOP  1->280 1ixkA  c.66.1.38 * 3e-67 31.7 %
:HMM:SCOP  1->282 1ixkA_ c.66.1.38 * 1.7e-62 33.5 %
:RPS:PFM   63->279 PF01189 * Nol1_Nop2_Fmu 7e-42 45.3 %
:HMM:PFM   64->279 PF01189 * Nol1_Nop2_Fmu 3.4e-38 33.8 216/283  
:BLT:SWISS 3->431 RSMF_ERWT9 8e-43 30.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55854.1 GT:GENE ACF55854.1 GT:PRODUCT NOL1/NOP2/sun family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1308788..1310092) GB:FROM 1308788 GB:TO 1310092 GB:DIRECTION - GB:PRODUCT NOL1/NOP2/sun family protein GB:NOTE identified by match to protein family HMM PF01189 GB:PROTEIN_ID ACF55854.1 GB:DB_XREF GI:194357406 LENGTH 434 SQ:AASEQ MQFPEGFVEKYKEILGDEARNFLASFEEEAVSAFRVNPLKEEQLSFSDAITQTPWGHYGKVSGKSPEHATGLVYSQEPAAQMVAQVAQPSPGMKVLDLAAAPGGKSTQLAAYXAGEGLLVSNEISSKRAKILVENMERFGATNVVVTNESADRLVKVFKGYFDLIVLDAPCSGEGMFRKQPDAMDYWSLDYPSQCASLQREILEDAVTMLAEGGRLVYSTCTWAPEENEEIVNWLLEEYDFDLLPVEHINGMVAGIDLPETARMYPHQFKGEGQFVAHLQFKGNNPAPKFKASKSNLSREQVALWQEFAQNHLKVNLPGILQTFGDQLYLLPELLPDLGKLKIARNGLHLGTFKKKRFEPSFALGLALKPSQVEQSVEIGQEAFVKYAAGEIVQLAESLPNGWYQVLVKGNGLGFAKVTGNVLKNYFPKGLRFK GT:EXON 1|1-434:0| BL:SWS:NREP 1 BL:SWS:REP 3->431|RSMF_ERWT9|8e-43|30.8|428/478| SEG 76->89|qepaaqmvaqvaqp| SEG 325->342|gdqlyllpellpdlgklk| BL:PDB:NREP 1 BL:PDB:REP 3->291|2frxB|3e-38|37.5|283/447| RP:PDB:NREP 1 RP:PDB:REP 91->289|2c7oA|1e-24|14.6|185/327| RP:PFM:NREP 1 RP:PFM:REP 63->279|PF01189|7e-42|45.3|212/229|Nol1_Nop2_Fmu| HM:PFM:NREP 1 HM:PFM:REP 64->279|PF01189|3.4e-38|33.8|216/283|Nol1_Nop2_Fmu| RP:SCP:NREP 1 RP:SCP:REP 1->280|1ixkA|3e-67|31.7|271/305|c.66.1.38| HM:SCP:REP 1->282|1ixkA_|1.7e-62|33.5|281/0|c.66.1.38|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1922 OP:NHOMOORG 944 OP:PATTERN 33133422111211132112111311111111---11111111-----1----95555554---12-- 11----11111111-------------------111-------------------------1---11---1---------11------1111-111---111111221-11111111-11111111111111-121--------1-21121111-1111-111111-22211111111111111--1111-22111111111111111111111111122211111111112311111111111111111111122222221222222221222211112222222222232222222222222222222222223222222121111111111111122111111212112221111121111212222-11111222222222212222222222222222122222-22-2222222222222112112223321222212222222222222211211222------------------------------2222121111222222222222222222222222222222222212112222112211222222221111222212211112121211122111112111121-4-11---1-1111-1-----------11-11332111111224544444444444444444--11221------22221222222222222-2222222222222222222222221112222222222222222122221221-111111111111--1211111111111-111111-11111-11111111111-1-12111111111111111111--------12222222222223311-1-1----11111-2---------------1------1---1--------1----------111-111-12 23334351D6622242221222222222222122122222222221222222221122222232222212233321222232222233-2222222222221233223A4A5543A5334457473384BX7-65D3341644543544243273655544735633524712533334U6641246862673876662 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 324 STR:RPRED 74.7 SQ:SECSTR HEETTEEEEEEccHHHTTHHHHHHHHHHcTTccEEEEEEccTTcccEEEEEEEccccEEEEEETTEEEccccccccTTHHHHHHHGGGccTTcEEEEETcTTTHHHHHHHHHHTTcEEEEEEcccHHHHHHHHHHHcccccccGGGccGGGcHHHHHHTccccEEEEEcccTTTcTTccccGGGcTTcGGGHHcHHHHHHHHHHHHcccEEEEEEEGGGGTTTTTHHHHHHHHHHHHEEEGGGGTcccccEEEEEEEEcGGGccccccccccccccccHHHHcccGGGccccccccccGGGTHHHHHHHcccTTcccccccccc############################################################################################################## DISOP:02AL 281-305| PSIPRED ccccHHHHHHHHHHcHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHcccccccccccccHHHHccEEEEEccHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHHcccccEEEEEcccHHccccccccccEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHcccEEEEcccccccccccccccEEEEccccccccEEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHccccccccEEEEEccEEEEEcccccHHcccEEEEccEEEEEEEccEEEEEHHHEEEccccccccEEEccHHHHHHHHcccEEEEcccccccEEEEEEccEEEEEEEEcccEEccccccHHccc //