[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55863.1
DDBJ      :             N-acetylneuraminate lyase
Swiss-Prot:             

Homologs  Archaea  60/68 : Bacteria  802/915 : Eukaryota  123/199 : Viruses  0/175   --->[See Alignment]
c.1.10
:305 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->294 1nal1 PDBj 2e-41 33.2 %
:RPS:PDB   3->293 3cprA PDBj 2e-60 21.8 %
:RPS:SCOP  1->305 1f5zA  c.1.10.1 * 1e-63 29.9 %
:HMM:SCOP  6->294 1dhpA_ c.1.10.1 * 3.2e-71 33.6 %
:RPS:PFM   8->297 PF00701 * DHDPS 1e-43 34.6 %
:HMM:PFM   7->293 PF00701 * DHDPS 3.4e-60 31.8 283/289  
:BLT:SWISS 5->301 NANA_SALA4 2e-42 33.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55863.1 GT:GENE ACF55863.1 GT:PRODUCT N-acetylneuraminate lyase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1527228..1528145) GB:FROM 1527228 GB:TO 1528145 GB:DIRECTION - GB:PRODUCT N-acetylneuraminate lyase GB:NOTE Steenbergen, S.M.: J Bacteriol. 2006 Sep;188(17):6195-206.; identified by match to protein family HMM PF00701 GB:PROTEIN_ID ACF55863.1 GB:DB_XREF GI:194357415 LENGTH 305 SQ:AASEQ MSDLKKYEGVIPAFYACYDDQGEVSPERTRALVQYFIDKGVQGLYVNGSSGECIYQSVEDRKLILEEVMAVAKGKLTIIAHVACNNTKDSMELARHAESLGVDAIATIPPIYFRLPXYSVAKYWNDISSAAPNTDYVIYNIPQLAGVALTPSLYTEMLKNPRVIGVKNSSMPVQDIQTFVSLGGEDHIVFNGPDEQFLGGRLMGARAGIGGTYGAMPELFLKLNQLIADKDLETARELQYAINAIIGKLTSAHGNMYGVIKEVLKINEGLNIGSVRSPLTPVTEEDRPVVEAAAALIRETKERFL GT:EXON 1|1-305:0| BL:SWS:NREP 1 BL:SWS:REP 5->301|NANA_SALA4|2e-42|33.7|294/297| BL:PDB:NREP 1 BL:PDB:REP 9->294|1nal1|2e-41|33.2|283/291| RP:PDB:NREP 1 RP:PDB:REP 3->293|3cprA|2e-60|21.8|284/301| RP:PFM:NREP 1 RP:PFM:REP 8->297|PF00701|1e-43|34.6|286/288|DHDPS| HM:PFM:NREP 1 HM:PFM:REP 7->293|PF00701|3.4e-60|31.8|283/289|DHDPS| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00701|IPR002220| GO:PFM GO:0016829|"GO:lyase activity"|PF00701|IPR002220| RP:SCP:NREP 1 RP:SCP:REP 1->305|1f5zA|1e-63|29.9|291/293|c.1.10.1| HM:SCP:REP 6->294|1dhpA_|3.2e-71|33.6|283/0|c.1.10.1|1/1|Aldolase| OP:NHOMO 1714 OP:NHOMOORG 985 OP:PATTERN 111---224444444221121111111-12211111111111111111111111111-1122222--- 326-122122212122211-151121111112445412651--11221111--111-2--111111344411---31122212111113423121111112111211315-111111-------111111-1-1-111111111-1--11111111111111-1111111-1111111111112--111112122222222222222225233312221331311111111231222222222222222112211--11---1-33111212-1111111111111211353333332331111111111111211111111212124111111121235111222111--113112211111-222112111113111111111115341113322-11111111113-113118111211833346354543422121123122112111111111121111311-11111----1111111111111----2121112211244424323332223333332321511321113111211232165111121111111111111-11111-111112111111111111111-1-131111-11122112--------1--111111222-11111112111111211112131122---111111111142323314224443422-2242233222254223222142432243232323333323223322222221122222222222211111111112111132322222222222222222122111211144342322133211211---------122222222212122112222222211111112111111----------1--------1--------1---1---11111121111-2 ------1--------1-2223334332221111222111111122212326787421-1-----3-------321--------------12---1---11---3-1--3-51122251-1-11-2214-781-42512111-11-1111-2-13-322322214311-121--31111--1--113---2-11241122 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 305 STR:RPRED 100.0 SQ:SECSTR HHTHHHHccEEEEccccccTTccccHHHHHHHHHHHHHTTccEEEEccTTTTTTTccHHHHHHHHHHHHHHHTTTcEEEEEcccccHHHHHHHHHHHHHTTccEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEEcHHHHcccccHHHHHHHTTcTTEEEEEccccHHHHHHHHHHHHHHccEEEEccGGGHHHHHHTTccEEEEcGGGTcHHHHHHHHHHHHHTcHHHHHHHHHHTHHHHHHHHHHcHHHHHHHHHHHHHTcTcccccccTTcccccHHHHHHHHHHHHHHccccHHHc DISOP:02AL 1-4| PSIPRED cccccccEEEEEEEcccccccccccHHHHHHHHHHHHHccccEEEEccccccHHHccHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHcccccEEEEEccccccccccHHHHHHHHccccEEEEEcccccHHHHHHHHHHccccEEEEEccHHHHHHHHHHcccEEEHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHcc //