[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55867.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  84/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:205 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   27->177 PF07314 * DUF1461 2e-29 51.0 %
:HMM:PFM   5->180 PF07314 * DUF1461 5.3e-60 47.7 174/181  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55867.1 GT:GENE ACF55867.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1311745..1312362) GB:FROM 1311745 GB:TO 1312362 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF55867.1 GB:DB_XREF GI:194357419 LENGTH 205 SQ:AASEQ MKTKLTFWGSMLFLLSLSILLTIYLAWIFYPMEIQWLNLTNRVYLKPETIQYNFHILMNYLTNPFSQVLQMPDFRSSAAGLHHFAVVKNLFHLVQLVALVTLPSFYVFVNRIVKKDFLSLYRKSLLALVVLPVMIGLGGVLIGFDQFFTLFHQILFVGDDTWLFDPAKDPVIMILPETFFLHAFLLFFALYENFFGYLYLKSRRK GT:EXON 1|1-205:0| TM:NTM 4 TM:REGION 8->30| TM:REGION 84->106| TM:REGION 125->147| TM:REGION 170->192| SEG 12->25|lfllslsilltiyl| SEG 179->190|fflhafllffal| RP:PFM:NREP 1 RP:PFM:REP 27->177|PF07314|2e-29|51.0|149/187|DUF1461| HM:PFM:NREP 1 HM:PFM:REP 5->180|PF07314|5.3e-60|47.7|174/181|DUF1461| OP:NHOMO 85 OP:NHOMOORG 84 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-111111------111-----------------------------------111-11--11111--11111---11121111111111111111111111111111111111111111111---1--------1-1-1------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,205-206| PSIPRED cccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccEEEcccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //