[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55872.1
DDBJ      :             pyruvate kinase
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  829/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
c.1.12c.49.1
:316 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->315 2e28A PDBj 2e-77 47.2 %
:RPS:PDB   1->315 1a3wB PDBj 3e-65 42.5 %
:RPS:SCOP  8->180 1liuA2  c.1.12.1 * 9e-68 50.0 %
:RPS:SCOP  196->315 1liuA3  c.49.1.1 * 3e-28 30.3 %
:HMM:SCOP  1->188 1liuA2 c.1.12.1 * 1.6e-65 50.3 %
:HMM:SCOP  187->316 1a49A3 c.49.1.1 * 3.5e-38 45.7 %
:RPS:PFM   1->179 PF00224 * PK 3e-58 59.6 %
:RPS:PFM   200->314 PF02887 * PK_C 6e-22 49.6 %
:HMM:PFM   1->185 PF00224 * PK 5.2e-93 58.2 184/348  
:HMM:PFM   199->313 PF02887 * PK_C 5.7e-35 44.3 115/117  
:BLT:SWISS 1->316 KPYK_LACLA e-139 78.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55872.1 GT:GENE ACF55872.1 GT:PRODUCT pyruvate kinase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 802133..803083 GB:FROM 802133 GB:TO 803083 GB:DIRECTION + GB:PRODUCT pyruvate kinase GB:NOTE contains potential frameshift; identified by match to protein family HMM PF00224; match to protein family HMM PF02887; match to protein family HMM TIGR01064 GB:PROTEIN_ID ACF55872.1 GB:DB_XREF GI:194357424 LENGTH 316 SQ:AASEQ MNIPNTKIPFPALAERDNDDIRFGLEQGINFIAISFVRTAKDVNEVRAICEETGNGHVQLFAXIENQQGIDNLDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIIKKVNAAGKVVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPLESVTTMATIDKNAQALLNEYGRLDSDSFERNSKTEVMASAVKDATSSMDIKLVVTLTKTGHTARLISKYRPNADILALTFDELTERGLMLNWGVIPMLTDAPSSTDDMFEIAERKAVEAGLVESGDDIVIVAGVPVGEAVRTNTMRIRTVR GT:EXON 1|1-316:0| BL:SWS:NREP 1 BL:SWS:REP 1->316|KPYK_LACLA|e-139|78.1|315/502| BL:PDB:NREP 1 BL:PDB:REP 13->315|2e28A|2e-77|47.2|303/587| RP:PDB:NREP 1 RP:PDB:REP 1->315|1a3wB|3e-65|42.5|313/489| RP:PFM:NREP 2 RP:PFM:REP 1->179|PF00224|3e-58|59.6|178/345|PK| RP:PFM:REP 200->314|PF02887|6e-22|49.6|115/117|PK_C| HM:PFM:NREP 2 HM:PFM:REP 1->185|PF00224|5.2e-93|58.2|184/348|PK| HM:PFM:REP 199->313|PF02887|5.7e-35|44.3|115/117|PK_C| GO:PFM:NREP 8 GO:PFM GO:0000287|"GO:magnesium ion binding"|PF00224|IPR015793| GO:PFM GO:0004743|"GO:pyruvate kinase activity"|PF00224|IPR015793| GO:PFM GO:0006096|"GO:glycolysis"|PF00224|IPR015793| GO:PFM GO:0030955|"GO:potassium ion binding"|PF00224|IPR015793| GO:PFM GO:0000287|"GO:magnesium ion binding"|PF02887|IPR015794| GO:PFM GO:0004743|"GO:pyruvate kinase activity"|PF02887|IPR015794| GO:PFM GO:0006096|"GO:glycolysis"|PF02887|IPR015794| GO:PFM GO:0030955|"GO:potassium ion binding"|PF02887|IPR015794| RP:SCP:NREP 2 RP:SCP:REP 8->180|1liuA2|9e-68|50.0|172/281|c.1.12.1| RP:SCP:REP 196->315|1liuA3|3e-28|30.3|119/134|c.49.1.1| HM:SCP:REP 1->188|1liuA2|1.6e-65|50.3|187/0|c.1.12.1|1/1|Phosphoenolpyruvate/pyruvate domain| HM:SCP:REP 187->316|1a49A3|3.5e-38|45.7|129/135|c.49.1.1|1/1|PK C-terminal domain-like| OP:NHOMO 1828 OP:NHOMOORG 1078 OP:PATTERN 111-111111111111111111--11111111---11111111-1-11-1111-11111111111--- 1211111222221111111-12111211111122221142111111111111111221111111111222111111111-1-1-11-11111-1--2--11111111111111111111111111---------1-11111---113423223211111111112232221111111111112111111111112222222212222221111112221221111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112311111113131111133321-1111121111211111111111111111111-11-1311221122222211111111111-2231352211111113111111112111-11111111111111111111111221------------------------------11111111112111111111111112222121113233112221111111112111311111-11111111221121111111111111111111112111111221211111111111-----------111333331311111212111111111111111111-1211211111122222222222222222-22222222222222222222222222322222222222222222222222221222222222222111111111111111111111111111111111----------6122222222222333111111111111122223333323233111111111111111121222222111111111-1111-1-1111111111111111111-211111111111 2211111-721233311111111111111111111111111111111111111111111211111111112111122-2211111111-121111121111113351253247344522222223A172Eb5-53B121142222-221221131212212232223513636114768*22255JAKJ1E775758B6 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 315 STR:RPRED 99.7 SQ:SECSTR EEcTTcccccccccHHHHHHHHHHHHHTccEEEEcccccHHHHHHHHHHHHHHHTTTcEEEEEEcccHHHHTHHHHHHHccEEEEcHHHHHHHTTGGGHHHHHHHHHHHHHHHTccEEEcccTTGGGGccccccHHHHHHHHHHHHHTccEEcccTTTTTcccHHHHHHHHHHHHHTcccHHHHHHHHTTcccccccHHHHHHHHHHHHHHHHTcccEEEEccccHHHHHHHHTcccccEEEEEccTTHHHHGGGcTTEEEEEcccccHHHHHHHHHHHHHHHTTcccTTcEEEEEEcccTTGTccccEEEEEEc# DISOP:02AL 1-1| PSIPRED ccccccccccccccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHccccccEEEEEEccHHHHHcHHHHHHHccEEEEccccccccccHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHccccccHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHcccccEEEEEccHHHHHHHHHHccEEEEEEcccccHHHHHHHHHHHHHHccccccccEEEEEccccccccccccEEEEEEEc //