[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55876.1
DDBJ      :             Tn5253 hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   54->125 PF10858 * DUF2659 1.2e-05 33.8 71/220  
:BLT:SWISS 44->117 MLP1_YEAST 2e-05 35.1 %
:REPEAT 2|34->67|68->104

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55876.1 GT:GENE ACF55876.1 GT:PRODUCT Tn5253 hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1225001..1225384) GB:FROM 1225001 GB:TO 1225384 GB:DIRECTION - GB:PRODUCT Tn5253 hypothetical protein GB:PROTEIN_ID ACF55876.1 GB:DB_XREF GI:194357428 LENGTH 127 SQ:AASEQ MTKDWNFNQPLESKSENQEDPDKIAALFRNHQGGNDVNYEAAFQKRKQAPVTDSNSSSKPKVTEVRTGKETDITTSYQQHLKRLIADNNSDIQSSQKKIEELHTFIDTKNKDNKKLQSIYDAISDLH GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 44->117|MLP1_YEAST|2e-05|35.1|74/1875| NREPEAT 1 REPEAT 2|34->67|68->104| HM:PFM:NREP 1 HM:PFM:REP 54->125|PF10858|1.2e-05|33.8|71/220|DUF2659| OP:NHOMO 13 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---1------111-1--1--------------11---2-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,9-23,44-72,92-92,95-95| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //