[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55877.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:105 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->91 3e4vA PDBj 2e-08 15.9 %
:RPS:SCOP  1->91 1ejeA  b.45.1.2 * 1e-07 17.2 %
:HMM:SCOP  1->88 1ejeA_ b.45.1.2 * 2.4e-10 25.3 %
:HMM:PFM   6->69 PF01613 * Flavin_Reduct 7.1e-07 22.6 53/155  
:BLT:SWISS 4->73 FLR_DESGI 3e-04 34.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55877.1 GT:GENE ACF55877.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 496620..496937 GB:FROM 496620 GB:TO 496937 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF55877.1 GB:DB_XREF GI:194357429 LENGTH 105 SQ:AASEQ MERLGVHYEISERTQIPILDACPLVLDCRVDRIVEEDGICHIFAKILERLVAPELLDEKGHFKNQLFAPTYFMGDGYQRVYRYLDKRVDMKGSFIKKARKKDGKN GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 4->73|FLR_DESGI|3e-04|34.8|69/100| RP:PDB:NREP 1 RP:PDB:REP 1->91|3e4vA|2e-08|15.9|82/173| HM:PFM:NREP 1 HM:PFM:REP 6->69|PF01613|7.1e-07|22.6|53/155|Flavin_Reduct| RP:SCP:NREP 1 RP:SCP:REP 1->91|1ejeA|1e-07|17.2|87/192|b.45.1.2| HM:SCP:REP 1->88|1ejeA_|2.4e-10|25.3|87/192|b.45.1.2|1/1|FMN-binding split barrel| OP:NHOMO 20 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111----------------------------------------------------------111111111111-------------1--111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 86.7 SQ:SECSTR HHHHTccEEccccccccEETTccEEEEEEEEEcTTHHHHcEEEEEEEEEEEcTTccccTccccHHHHccEEEccTTEEEcccccccGGGTT############## DISOP:02AL 1-1,96-98,101-106| PSIPRED cccEEEEEEEccccccEEEEEccEEEEEEEEEEEEEccEEEEEEEEEEEEEcHHHccccccccHHHccEEEEEccccEEEEEHHccHHHHHHHHHHHHHHccccc //