[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55886.1
DDBJ      :             site-specific recombinase, phage integrase family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  4/175   --->[See Alignment]
d.163.1
:148 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   44->143 2a3vB PDBj 5e-08 19.6 %
:RPS:SCOP  91->141 1crxA2  d.163.1.1 * 2e-06 10.0 %
:HMM:SCOP  47->138 1a0pA2 d.163.1.1 * 4.6e-16 36.7 %
:RPS:PFM   50->129 PF00589 * Phage_integrase 6e-06 33.8 %
:HMM:PFM   33->131 PF00589 * Phage_integrase 1.4e-20 30.2 96/173  
:HMM:PFM   9->52 PF10566 * Glyco_hydro_97 0.00067 31.7 41/643  
:BLT:SWISS 37->142 P2IN_LACLA 6e-19 41.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55886.1 GT:GENE ACF55886.1 GT:PRODUCT site-specific recombinase, phage integrase family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1008231..1008677) GB:FROM 1008231 GB:TO 1008677 GB:DIRECTION - GB:PRODUCT site-specific recombinase, phage integrase family GB:NOTE identified by match to protein family HMM PF00589 GB:PROTEIN_ID ACF55886.1 GB:DB_XREF GI:194357438 LENGTH 148 SQ:AASEQ MRKHGLISKSTSKRYYQVAIPFTRLFCPALVSIDYINCLSETTDKNWHKSDRIFVTNIGKPVHSSILSKSLQRANERLKKPIPKHLPPHIFRHTTISILSENKIPLKTITDRVGHSDSEVTTSIYTQVTKNMKDEAINVLDKVMKKIF GT:EXON 1|1-148:0| BL:SWS:NREP 1 BL:SWS:REP 37->142|P2IN_LACLA|6e-19|41.5|106/382| SEG 78->90|lkkpipkhlpphi| RP:PDB:NREP 1 RP:PDB:REP 44->143|2a3vB|5e-08|19.6|97/320| RP:PFM:NREP 1 RP:PFM:REP 50->129|PF00589|6e-06|33.8|77/168|Phage_integrase| HM:PFM:NREP 2 HM:PFM:REP 33->131|PF00589|1.4e-20|30.2|96/173|Phage_integrase| HM:PFM:REP 9->52|PF10566|0.00067|31.7|41/643|Glyco_hydro_97| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF00589|IPR002104| GO:PFM GO:0006310|"GO:DNA recombination"|PF00589|IPR002104| GO:PFM GO:0015074|"GO:DNA integration"|PF00589|IPR002104| RP:SCP:NREP 1 RP:SCP:REP 91->141|1crxA2|2e-06|10.0|50/212|d.163.1.1| HM:SCP:REP 47->138|1a0pA2|4.6e-16|36.7|90/182|d.163.1.1|1/1|DNA breaking-rejoining enzymes| OP:NHOMO 36 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----11------------1----------------------1-1-1---1----1-1-12---21211111-12-122-------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------1-------------------------------------------------------------1---------1-------------------------------------1------------------------------------------------- STR:NPRED 109 STR:RPRED 73.6 SQ:SECSTR #################################TccccccccTEEEEEEEETTTTEEEEEEccHHHHHHHHHHHHHHHTccccccHHHTTHHHHHHHHHHHTTccHHHHHHHcccccHH#HHHHHHHHHHTcTTTcccGGGTc##### DISOP:02AL 1-2| PSIPRED cccccEEEEEccccccEEEEEccHHHHHHHHHHHHHHHHHHHHccccccccEEEEccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHc //