[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55890.1
DDBJ      :             cell wall surface anchor family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:553 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   213->293 PF11966 * SSURE 1e-29 84.0 %
:RPS:PFM   363->445 PF11966 * SSURE 4e-28 81.9 %
:HMM:PFM   213->293 PF11966 * SSURE 4.5e-47 87.7 81/81  
:HMM:PFM   363->445 PF11966 * SSURE 1.4e-42 72.8 81/81  
:HMM:PFM   6->32 PF04650 * YSIRK_signal 8.4e-13 51.9 27/27  
:HMM:PFM   517->549 PF00746 * Gram_pos_anchor 7.7e-06 38.7 31/39  
:BLT:SWISS 85->313 PLS_STAAU 5e-04 30.4 %
:REPEAT 2|149->293|299->445
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55890.1 GT:GENE ACF55890.1 GT:PRODUCT cell wall surface anchor family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 84443..86104 GB:FROM 84443 GB:TO 86104 GB:DIRECTION + GB:PRODUCT cell wall surface anchor family protein GB:NOTE identified by match to protein family HMM PF00746; match to protein family HMM PF04650; match to protein family HMM TIGR01167; match to protein family HMM TIGR01168 GB:PROTEIN_ID ACF55890.1 GB:DB_XREF GI:194357442 LENGTH 553 SQ:AASEQ MKFNPNQRYTRWSIRRLSVGVASVVVASGFFVLVGQPSSVRADVVNPTPGQVLPEETSGTKEGDLSEKPGDTVLTQAKPEGVTGNTNSLPTPTERTEVSEETNSSSLDTLFEKDEEAQKNPELTDVLKETVDTADVDGTQASPAETTPEQVKGGVKENTKDSIDVPAAYLEKAEGKGPFTAGVNQVIPYELFAGDGMLTRLLLKASDNAPWSDNGTAKNPALPPLEGLTKGKYFYEVDLNGNTVGKQGQALIDQLRANGTQTYKATVKVYGNKDGKADLTNLVATKNVDININGLVAKETVQKAVADNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYELFAGDGMLTRLLLKASDKAPWSDNGDAKNPALSPLGENVKTKGQYFYQXALDGNVAGKEKQALIDQFRANGTQTYSATVNVYGNKDGKPDLDNIVATKKVTIKINVKETSDTANGSLSPSNSGSGVTPMNHNHATGTTDSMPADTMTSSTNTMAGENMAASANKMSDTMMSEDKAMLPNTGETQTSMASIGFLGLALAGLLGGLGLKNKKEEN GT:EXON 1|1-553:0| BL:SWS:NREP 1 BL:SWS:REP 85->313|PLS_STAAU|5e-04|30.4|217/1637| NREPEAT 1 REPEAT 2|149->293|299->445| SEG 17->35|lsvgvasvvvasgffvlvg| SEG 454->465|ngslspsnsgsg| SEG 533->546|lglalagllgglgl| RP:PFM:NREP 2 RP:PFM:REP 213->293|PF11966|1e-29|84.0|81/81|SSURE| RP:PFM:REP 363->445|PF11966|4e-28|81.9|81/81|SSURE| HM:PFM:NREP 4 HM:PFM:REP 213->293|PF11966|4.5e-47|87.7|81/81|SSURE| HM:PFM:REP 363->445|PF11966|1.4e-42|72.8|81/81|SSURE| HM:PFM:REP 6->32|PF04650|8.4e-13|51.9|27/27|YSIRK_signal| HM:PFM:REP 517->549|PF00746|7.7e-06|38.7|31/39|Gram_pos_anchor| OP:NHOMO 20 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111----1--1111111-111-------------1--111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,4-6,42-44,46-75,84-123,131-163,450-518,545-554| PSIPRED ccccHHHHccEEHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccHHHHHcccccccEEcccccccccccccccccccccccccHHHHHHHHccccccccccccccHHHHccccHHEEEEHHccccccccccccccccccccccccccccEEEEEEEcccccccHHHHHHHHHHHcccEEEEEEEEEEEccccccHHHHcccccEEEEEcccccHHHHHHHHHHHHHHHHccccHHHHHHHcccccccccccccccHHHHccccHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEccccccccHHHHHHHHHHccccEEEEEEEEEEEcccccccHHHHHcccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccc //