[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55898.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:224 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   32->220 PF09922 * DUF2154 9e-09 29.4 %
:HMM:PFM   8->220 PF09922 * DUF2154 7.1e-19 18.6 204/233  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55898.1 GT:GENE ACF55898.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1743585..1744259) GB:FROM 1743585 GB:TO 1744259 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55898.1 GB:DB_XREF GI:194357450 LENGTH 224 SQ:AASEQ MKKKAFGIVLLVLAAWILLQGNFGIPSLDGKIWPLLGIVFFAYKSIESILRRHLTSAVFTGLLALIIANYAYDLLPVTNHSLIWASILVVLGVGYLTHSSKFWNEKKWWYNGKKTVVTDKEVAFGSGTFYKQDQDLVDDQVEVAFGDAKIYYDNAEMLGDFATLNIEVAFGNATVYVPQHWRVDLKVETSFGAAKADAPVAPTSKTLIIHGDVAFGKLEIVYAK GT:EXON 1|1-224:0| TM:NTM 4 TM:REGION 5->27| TM:REGION 29->50| TM:REGION 53->75| TM:REGION 79->101| SEG 8->19|ivllvlaawill| SEG 132->143|qdqdlvddqvev| RP:PFM:NREP 1 RP:PFM:REP 32->220|PF09922|9e-09|29.4|177/220|DUF2154| HM:PFM:NREP 1 HM:PFM:REP 8->220|PF09922|7.1e-19|18.6|204/233|DUF2154| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1--11111111111-------------111--1111-----1----11---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHHccccccccHHHccccccEEEEEccEEcccccEEEEEEEEEEEEEEEEEEccEEEEEEccccccccEEEEEEEEEccEEEEEcccEEEEEEEccccccEEccccccccccEEEEEEEEEEcEEEEEEEc //