[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55900.1
DDBJ      :             choline binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  4/175   --->[See Alignment]
b.109.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->129 3hiaB PDBj 2e-49 97.6 %
:RPS:PDB   51->124 1e88A PDBj 1e-11 9.5 %
:RPS:SCOP  51->128 2bibA1  b.109.1.1 * 8e-19 33.8 %
:HMM:SCOP  51->129 2bibA1 b.109.1.1 * 6.5e-24 46.2 %
:HMM:PFM   51->69 PF01473 * CW_binding_1 6.7e-06 52.6 19/19  
:HMM:PFM   71->89 PF01473 * CW_binding_1 1.7e-11 57.9 19/19  
:HMM:PFM   92->109 PF01473 * CW_binding_1 8.4e-08 33.3 18/19  
:BLT:SWISS 48->115 LYS_BPCP9 6e-15 44.1 %
:REPEAT 3|51->69|71->89|91->110

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55900.1 GT:GENE ACF55900.1 GT:PRODUCT choline binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1320590..1320979) GB:FROM 1320590 GB:TO 1320979 GB:DIRECTION - GB:PRODUCT choline binding protein GB:NOTE identified by match to protein family HMM PF01473 GB:PROTEIN_ID ACF55900.1 GB:DB_XREF GI:194357452 LENGTH 129 SQ:AASEQ MVKRRIRRGTREPEKVVVPEQSSIPSYPVSVTSNQGTDVAVEPAKAVAPTTGWKQENGMWYFYNIDGSMATGWVQVNDSWYYLNSNGSMKVNQWFQVGGKWYYVNTSGELAVNTSIDGYRVNDNGEWVR GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 48->115|LYS_BPCP9|6e-15|44.1|68/339| NREPEAT 1 REPEAT 3|51->69|71->89|91->110| BL:PDB:NREP 1 BL:PDB:REP 47->129|3hiaB|2e-49|97.6|83/83| RP:PDB:NREP 1 RP:PDB:REP 51->124|1e88A|1e-11|9.5|74/160| HM:PFM:NREP 3 HM:PFM:REP 51->69|PF01473|6.7e-06|52.6|19/19|CW_binding_1| HM:PFM:REP 71->89|PF01473|1.7e-11|57.9|19/19|CW_binding_1| HM:PFM:REP 92->109|PF01473|8.4e-08|33.3|18/19|CW_binding_1| RP:SCP:NREP 1 RP:SCP:REP 51->128|2bibA1|8e-19|33.8|77/232|b.109.1.1| HM:SCP:REP 51->129|2bibA1|6.5e-24|46.2|78/0|b.109.1.1|1/1|Cell wall binding repeat| OP:NHOMO 291 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------25-L------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--CAADCCCABEA---------------------------m-------X-Y-1---554-------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------1---------------------------------------------------------1---------------------------------------------------1-1----------------------------------------------- STR:NPRED 99 STR:RPRED 76.7 SQ:SECSTR ##############################EEEcTTccEEEEcccccGGEccEEccccccccGGGTcccccccEEETTEEEcccccccccccccEEEccccHHHHccEEEccTTccccccEEETccccc DISOP:02AL 1-44| PSIPRED cHHHHHHccccccccccccccccccccccEEccccccccccccccccccEEEEEEEccEEEEEcccccEEEEEEEEccEEEEEccccccccccEEEEccEEEEEcccccEEEEEEEEEEEEcccccccc //