[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55904.1
DDBJ      :             NADP-dependent glyceraldehyde-3-phosphate dehydrogenase
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  798/915 : Eukaryota  190/199 : Viruses  0/175   --->[See Alignment]
c.82.1
:474 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->474 1euhA PDBj 0.0 68.9 %
:RPS:PDB   1->470 2bhpA PDBj e-103 28.8 %
:RPS:SCOP  3->474 1euhA  c.82.1.1 * e-111 71.6 %
:HMM:SCOP  1->472 1uzbA_ c.82.1.1 * 1.1e-146 41.9 %
:RPS:PFM   28->455 PF00171 * Aldedh 3e-75 41.9 %
:HMM:PFM   13->469 PF00171 * Aldedh 4.1e-153 41.7 451/462  
:BLT:SWISS 3->474 GAPN_STRMU 0.0 68.6 %
:PROS 276->287|PS00070|ALDEHYDE_DEHYDR_CYS
:PROS 248->255|PS00687|ALDEHYDE_DEHYDR_GLU
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55904.1 GT:GENE ACF55904.1 GT:PRODUCT NADP-dependent glyceraldehyde-3-phosphate dehydrogenase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 996935..998359 GB:FROM 996935 GB:TO 998359 GB:DIRECTION + GB:PRODUCT NADP-dependent glyceraldehyde-3-phosphate dehydrogenase GB:NOTE identified by match to protein family HMM PF00171 GB:PROTEIN_ID ACF55904.1 GB:DB_XREF GI:194357456 LENGTH 474 SQ:AASEQ MTRYQNLVNGKWKSSEQEITIYSPINQEELGTVPAMTQTEADEAMQAARAALPXWXALSAIERAAYLHKTAAILERDKEKIGTILAKEVAKGIKAAIGEVVRTADLIRYAAEEGXRITGQAMEGGGFEAASKNKLAVVRREPVGIVLAIAPFNYPVNLSASKIAPALIAGNVVMFKPPTQGSISGLLLAKAFEEAGIPAGVFNTITGRGSEIGDYIIEHKEVNFINFTGSTPIGERIGRLAGMRPIMLELGGKDAALVLEDADLEHAAKQIVAGAFSYSGQRCTAIKRVIVLESVADKLATLLQEEVSKLTVGDPFDNADITPVIDNASADFIWGLIEDAQEKEAQALTPIKREGNLLWPVLFDQVTKDMKVAWEEPFGPVLPIIRVASVEEAIAFANESEFGLQSSVFTNDFKKAFEIAEKLEVGTVHINNKTQRGPDNFPFLGVKGSGAGVQGIKYSIEAMTNVKSIVFDVK GT:EXON 1|1-474:0| BL:SWS:NREP 1 BL:SWS:REP 3->474|GAPN_STRMU|0.0|68.6|472/475| PROS 276->287|PS00070|ALDEHYDE_DEHYDR_CYS|PDOC00068| PROS 248->255|PS00687|ALDEHYDE_DEHYDR_GLU|PDOC00068| SEG 41->60|adeamqaaraalpxwxalsa| BL:PDB:NREP 1 BL:PDB:REP 3->474|1euhA|0.0|68.9|472/474| RP:PDB:NREP 1 RP:PDB:REP 1->470|2bhpA|e-103|28.8|466/516| RP:PFM:NREP 1 RP:PFM:REP 28->455|PF00171|3e-75|41.9|420/440|Aldedh| HM:PFM:NREP 1 HM:PFM:REP 13->469|PF00171|4.1e-153|41.7|451/462|Aldedh| GO:PFM:NREP 3 GO:PFM GO:0008152|"GO:metabolic process"|PF00171|IPR015590| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00171|IPR015590| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00171|IPR015590| RP:SCP:NREP 1 RP:SCP:REP 3->474|1euhA|e-111|71.6|472/474|c.82.1.1| HM:SCP:REP 1->472|1uzbA_|1.1e-146|41.9|468/516|c.82.1.1|1/1|ALDH-like| OP:NHOMO 10197 OP:NHOMOORG 1044 OP:PATTERN 331-1-4754454653-312111-A4432-521-11111111211222124431-1--1-13351--1 7A95M947AAE547KPK9A-9O22Kb99999GSQWSMW**8N7V68781744WKPC9B--DEQ3BENMKKA----111-121H11111--12-211---62637484756--------------12222221221277787---64455334413111113122324555411111111111187856-1-C89999998AAAA99887EDAA6B9AB9HFDF86333332D54555555555555558667711112311111121122-11122---2222111-221111111111122212222222221--111---2-11172223223222-211-2223113131---2211---1--2---1118-6HEEA11111B6GBK546AA7A7FGHIFDHCHGH-45D43I6AOOB-NJJLLLWRNYRREAAC5BHRCAAC8JJEDEEEEEEADC6466911111111----1111-1111-11-11118APcB2CPLDEeZbbZcRLLLHcbcgRQONCOvWwNdWL14GCFE9CB9HENDLP333-112B62444444132BC664413331332223-3333435443333AA15211322211211111111112-11143982894K7DB9AAAAA9AB888997AC9AE-1-5421------C968588CAA9C989CD-ADBDA98D8CA9BCCBCCBJMJ99994CBABBABBBC99C9B9J883667721567688758888--1633122888817DKY222112-----2223LKMHI8H7C9H1KKKKLQPUHTTPPCKHJ3211132122433A566668B88B8999997555------1-441111--------2-2----1---1-12-111-12--111111112-2-2-331 ----CCA-A54-8B8IILKQNQKTTSREECCCCEEDEFEEEEEBDDDDKUUe*nNMGCDDDCD9B6AA4B88C9A894998AA9AC57-IUEICGEFCD9B8GFCF-9MBWOiILONBCDAEKEPQAWCv*Q-SPUCGC9SFGOEAGEDBI88aCFDGOKcWCMFFATBEGAKNC5775*6656ALFcVLJo88VGMKJ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 474 STR:RPRED 100.0 SQ:SECSTR TEEEcEEETTEEEccccEEEEEcTTcTTcEEEEEcccHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHGGGGccccccccccccccTTEEEEEEEEEccEEEEEcccccTTHHHHHHHHHHHHTTcEEEEEccGGGHHHHHHHHHHHHHHTccTTcEEEccccTTTHHHHHHHcTTccEEEEEccHHHHHHHHHHHTccEEEEEccccEEEEEcTTccHHHHHHHHHHHHHGGGGccTTcEEEEEEEHHHHHHHHHHHHHHHTTcccccGGGcccccccccHHHHHHHHHHHHHHTTTcEEEEccccccccccccEEEEcccTTcGGGTccccccEEEEEEEccHHHHHHHHHccccccEEEEEcccHHHHHHHHHHccccEEEEccccccccTTccccccGGGcccccTcHHHHHTTEEEEEEEEEcc PSIPRED ccEEEEEEccEEEccccEEEEEccccccEEEEEccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccccccccccEEEEEEEccccEEEEEEcccHHHHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHccccccEEEEcccHHHHHHHHHHHcccEEEEEccccccEEEcccccHHHHHHHHHHHHHHHcccEEEccEEEEEEccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEccccccEEEccEEccccccccEEEEEcccccEEEEEEEccHHHHHHHHcccccccEEEEEcccHHHHHHHHHHccccEEEEcccccccHHHccccccccccccccccHHHHHHHHcEEEEEEEEc //