[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55908.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  99/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.82.2
:150 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->136 1s4cB PDBj 2e-05 23.0 %
:RPS:SCOP  1->131 1jopA  b.82.2.7 * 3e-29 24.6 %
:HMM:SCOP  1->152 1jopA_ b.82.2.7 * 1.5e-42 36.4 %
:RPS:PFM   1->150 PF04074 * DUF386 4e-24 40.0 %
:HMM:PFM   1->150 PF04074 * DUF386 1.9e-54 45.3 150/153  
:BLT:SWISS 23->150 YIAL_ECOLI 2e-09 26.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55908.1 GT:GENE ACF55908.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1542632..1543084) GB:FROM 1542632 GB:TO 1543084 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF04074; match to protein family HMM TIGR00022 GB:PROTEIN_ID ACF55908.1 GB:DB_XREF GI:194357460 LENGTH 150 SQ:AASEQ MIITKISRLGTYVGVNPHFATLIDFLEKTGLENLTEGSIAIDGNRLFGNCFTXLADGQAGAFFETHQKYLDIHLVLENEEAMAVTSPENVSVTQEYDEEKDIELYTGKVEQLVHLRAGECLITFPEDLHQPKVRINDEPVKKVVFKVAIS GT:EXON 1|1-150:0| BL:SWS:NREP 1 BL:SWS:REP 23->150|YIAL_ECOLI|2e-09|26.6|128/155| BL:PDB:NREP 1 BL:PDB:REP 1->136|1s4cB|2e-05|23.0|135/155| RP:PFM:NREP 1 RP:PFM:REP 1->150|PF04074|4e-24|40.0|150/153|DUF386| HM:PFM:NREP 1 HM:PFM:REP 1->150|PF04074|1.9e-54|45.3|150/153|DUF386| RP:SCP:NREP 1 RP:SCP:REP 1->131|1jopA|3e-29|24.6|122/140|b.82.2.7| HM:SCP:REP 1->152|1jopA_|1.5e-42|36.4|151/0|b.82.2.7|1/1|Clavaminate synthase-like| OP:NHOMO 107 OP:NHOMOORG 99 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1-1-------1111-------1-1---1----------------------------1-------------------------------------------------------------------------------------------------1--------------------------------------1--------------1--21122212121-------------1--------1---1------------1---111-------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--------------------1---------------------------1--------------------------------------11111-11111-11-11--------------12--------1-1-1--------11----1--------1------1-1111111111111-----------11-111111111---------------------1-1------------------------------------------------2111-----------------------------------------------------1--1-111-1--11---------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 135 STR:RPRED 90.0 SQ:SECSTR cEEEETTcTTTTTTccHHHHHHHHHHTTccGGGcccEEEEcc#cccEEEEEccccccGGGccEEEcccEEEEEEEEEccEEEEEcccccGGGcccccTTTTcEEEcccTTEEEEEcTTEEEEEcTTccEEEEEccT############## PSIPRED cEEccHHHHHHHccccHHHHHHHHHHHHccHHHcccccEEccccEEEEEEEEcccccccccccEEEEEEEEEEEEEEccEEEEEEEHHHccEEEcccccccEEEEcccccEEEEEccccEEEEcccHHccccccccccEEEEEEEEEEcc //