[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55918.1
DDBJ      :             IS630-Spn1, transposase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.1
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   8->60 3bp8B PDBj 2e-04 11.3 %
:RPS:SCOP  3->83 1pdnC  a.4.1.5 * 8e-07 17.3 %
:HMM:SCOP  2->99 1pdnC_ a.4.1.5 * 5.1e-14 27.6 %
:RPS:PFM   3->106 PF01710 * Transposase_14 3e-23 54.8 %
:HMM:PFM   1->112 PF01710 * Transposase_14 1.2e-54 56.0 109/120  
:BLT:SWISS 16->103 SETMR_HUMAN 6e-04 26.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55918.1 GT:GENE ACF55918.1 GT:PRODUCT IS630-Spn1, transposase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 721391..721741 GB:FROM 721391 GB:TO 721741 GB:DIRECTION + GB:PRODUCT IS630-Spn1, transposase GB:NOTE identified by match to protein family HMM PF01710 GB:PROTEIN_ID ACF55918.1 GB:DB_XREF GI:194357470 LENGTH 116 SQ:AASEQ MAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWLKLKEKTGELNHQVKGTKPRKVDRDRLKNYLTDNPDAYLTEIVSEFGCHPTTIHYALKAMGYTRKKRTTPTMNKSQKK GT:EXON 1|1-116:0| BL:SWS:NREP 1 BL:SWS:REP 16->103|SETMR_HUMAN|6e-04|26.1|88/100| RP:PDB:NREP 1 RP:PDB:REP 8->60|3bp8B|2e-04|11.3|53/380| RP:PFM:NREP 1 RP:PFM:REP 3->106|PF01710|3e-23|54.8|104/114|Transposase_14| HM:PFM:NREP 1 HM:PFM:REP 1->112|PF01710|1.2e-54|56.0|109/120|Transposase_14| RP:SCP:NREP 1 RP:SCP:REP 3->83|1pdnC|8e-07|17.3|81/123|a.4.1.5| HM:SCP:REP 2->99|1pdnC_|5.1e-14|27.6|98/0|a.4.1.5|1/1|Homeodomain-like| OP:NHOMO 186 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------4-------------------------15K-----------Q-----7----------------------------------------------------------------------------------------------------------------------8735437-467--------------44---444--------------------------------------------------3-------------------------------------------------------------------------------------------------------G-----------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------O-------------------------------------12--------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 68.1 SQ:SECSTR #HHTccHHHHHHHHTTTcccccHHHHHTTccccTTTHHHHHHHTTTcEEEcccEEEccccccccEEEEcccHHHHHHHHH#################################### DISOP:02AL 1-1,44-62,108-117| PSIPRED ccccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHccccEEcccccHHHHcccc //