[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55931.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.6.1
:123 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   47->118 2dv6A PDBj 4e-06 8.3 %
:RPS:SCOP  42->123 1aacA  b.6.1.1 * 2e-07 18.3 %
:HMM:SCOP  14->122 1ibyA_ b.6.1.4 * 7.6e-17 24.5 %
:HMM:PFM   4->49 PF06682 * DUF1183 3.6e-05 23.9 46/321  
:BLT:SWISS 41->123 CRK29_ARATH 8e-04 30.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55931.1 GT:GENE ACF55931.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 646704..647075 GB:FROM 646704 GB:TO 647075 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55931.1 GB:DB_XREF GI:194357483 LENGTH 123 SQ:AASEQ MLNSIVTIICIALIAFILFWFFKKPEKSGQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAGEFGFACGMNMMHGKMIVE GT:EXON 1|1-123:0| BL:SWS:NREP 1 BL:SWS:REP 41->123|CRK29_ARATH|8e-04|30.1|83/100| TM:NTM 1 TM:REGION 1->22| SEG 8->22|iicialiafilfwff| RP:PDB:NREP 1 RP:PDB:REP 47->118|2dv6A|4e-06|8.3|72/422| HM:PFM:NREP 1 HM:PFM:REP 4->49|PF06682|3.6e-05|23.9|46/321|DUF1183| RP:SCP:NREP 1 RP:SCP:REP 42->123|1aacA|2e-07|18.3|82/105|b.6.1.1| HM:SCP:REP 14->122|1ibyA_|7.6e-17|24.5|106/0|b.6.1.4|1/1|Cupredoxins| OP:NHOMO 75 OP:NHOMOORG 48 OP:PATTERN -------------------------------------------------------------------- ------------------------1-------------------------------------1--------1111111---------------------------------------------------------------------111-----11-----------2-------------------------------------------------------------------------------------211--122221-22---2--------------2--12222222222-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------33132--------------------------------------111---------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 68.3 SQ:SECSTR #######################################EEEEccTTTcccccEEEETTcEEEEEEEcccccccccEETTTTEEccccccTTcEEEEEEEccccEEEEEEcTTHHHHTEEEEc DISOP:02AL 1-2,29-32| PSIPRED cccEEEEHHHHHHHHHHEEEEEEccccccEEEEEEcccEEEEEEEcccccccEEEEccccEEEEEEEcccccccccEEEEcccccEEEcccccEEEEEEcccccEEEEEEEccccEEEEEEEc //