[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55940.1
DDBJ      :             CAAX amino terminal protease family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:203 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   114->200 PF02517 * Abi 6.1e-22 34.5 87/99  
:BLT:SWISS 68->203 YVDC_LACLA 1e-07 23.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55940.1 GT:GENE ACF55940.1 GT:PRODUCT CAAX amino terminal protease family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 482343..482954 GB:FROM 482343 GB:TO 482954 GB:DIRECTION + GB:PRODUCT CAAX amino terminal protease family GB:NOTE identified by match to protein family HMM PF02517 GB:PROTEIN_ID ACF55940.1 GB:DB_XREF GI:194357492 LENGTH 203 SQ:AASEQ MEFFDKFHALCFGFLVLIIVITVPYTINHGDFFQNESALIIVSLLVTSLSVAYARKFEMISFGMLSKKQLLLFIAIFLLSVLETLVYIHFFAVSSGSGVQHLAEVSRGISLSLILTTSVFGPIQEELIFRGLLQGAVFDNSWLGLVLTSSLFSFMHGPSNVPSFIFYLLGGLLLGFAYKKSQNLWVSTLVHMLYNSWPLLYYL GT:EXON 1|1-203:0| BL:SWS:NREP 1 BL:SWS:REP 68->203|YVDC_LACLA|1e-07|23.5|136/261| TM:NTM 6 TM:REGION 3->25| TM:REGION 33->54| TM:REGION 69->91| TM:REGION 102->124| TM:REGION 130->152| TM:REGION 157->178| SEG 37->52|saliivsllvtslsva| SEG 168->175|llgglllg| HM:PFM:NREP 1 HM:PFM:REP 114->200|PF02517|6.1e-22|34.5|87/99|Abi| OP:NHOMO 26 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1---------------------------------1------------------------1-----111-1111--11111111211----------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcc //