[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55952.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y887_STRP7   RecName: Full=UPF0078 membrane protein SP70585_0887;

Homologs  Archaea  0/68 : Bacteria  610/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:213 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   8->156 PF02660 * DUF205 2e-27 48.3 %
:HMM:PFM   8->192 PF02660 * DUF205 1.7e-54 44.1 177/178  
:BLT:SWISS 1->213 Y887_STRP7 e-111 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55952.1 GT:GENE ACF55952.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(747657..748298) GB:FROM 747657 GB:TO 748298 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF02660; match to protein family HMM TIGR00023 GB:PROTEIN_ID ACF55952.1 GB:DB_XREF GI:194357504 LENGTH 213 SQ:AASEQ MITIVLLILAYLLGSIPSGLWIGQVFFQINLREHGSGNTGTTNTFRILGKKAGMATFVIDFFKGTLATLLPIIFHLQGVSPLIFGLLAVIGHTFPIFAGFKGGKAVATSAGVIFGFAPIFCLYLAIIFFGALYLGSMISLSSVTASIAAVIGVLLFPLFGFILSNYDSLFIAIILALASLIIIRHKDNIARIKNKTENLVPWGLNLTHQDPKK GT:EXON 1|1-213:0| SW:ID Y887_STRP7 SW:DE RecName: Full=UPF0078 membrane protein SP70585_0887; SW:GN OrderedLocusNames=SP70585_0887; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->213|Y887_STRP7|e-111|100.0|213/213| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 5 TM:REGION 6->28| TM:REGION 64->86| TM:REGION 108->130| TM:REGION 139->161| TM:REGION 163->184| SEG 171->183|iaiilalasliii| RP:PFM:NREP 1 RP:PFM:REP 8->156|PF02660|2e-27|48.3|149/178|DUF205| HM:PFM:NREP 1 HM:PFM:REP 8->192|PF02660|1.7e-54|44.1|177/178|DUF205| GO:PFM:NREP 1 GO:PFM GO:0005886|"GO:plasma membrane"|PF02660|IPR003811| OP:NHOMO 672 OP:NHOMOORG 611 OP:PATTERN -------------------------------------------------------------------- 111---------------------------------------------------------------------------1111111111-----------------11111---------------11111111121---113341-1-1-1111-11111111111111121111111111111111132111133333223122221211111122211131111111111211111111111111111111121211212221111111111111111111111111111111111111111111111111111111111131111111-----1-11------2-1111111111111122211213111-1-111111111--1-111------11111111111-11-11-1--1-11--111-212-1---1-11111111-111111111-11--11-1111111111---------------111111---11----------1-------1---------111111111--11111-11-1--1111-1-------1111-1---111111111111111111111--1-----11111111111111111111-1111----11--11111-----1111111111-111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-111111111111---111111111111-1-------------111111-1----1-1111111111111-1111111111-11--------------1111111111----------111111-11111-1---11111111121221212211-1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 210-214| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc //