[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55953.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
b.40.6c.37.1
:376 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->376 1g291 PDBj 4e-96 52.2 %
:RPS:PDB   3->376 2d62A PDBj 4e-53 40.7 %
:RPS:SCOP  4->248 1b0uA  c.37.1.12 * 3e-47 30.2 %
:RPS:SCOP  222->375 1q12A1  b.40.6.3 * 7e-23 19.5 %
:HMM:SCOP  4->246 1g2912 c.37.1.12 * 5.7e-66 39.8 %
:HMM:SCOP  248->375 1q12A1 b.40.6.3 * 2.1e-27 39.1 %
:RPS:PFM   45->164 PF00005 * ABC_tran 3e-24 46.2 %
:HMM:PFM   45->163 PF00005 * ABC_tran 1.5e-24 36.3 113/118  
:HMM:PFM   293->367 PF08402 * TOBE_2 1.8e-10 26.1 69/75  
:HMM:PFM   17->59 PF03193 * DUF258 3.6e-06 28.6 42/161  
:BLT:SWISS 1->375 MSMK_STRMU e-153 72.5 %
:PROS 136->150|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55953.1 GT:GENE ACF55953.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1450751..1451881) GB:FROM 1450751 GB:TO 1451881 GB:DIRECTION - GB:PRODUCT ABC transporter, ATP-binding protein GB:NOTE identified by match to protein family HMM PF00005; match to protein family HMM PF03459; match to protein family HMM PF08402 GB:PROTEIN_ID ACF55953.1 GB:DB_XREF GI:194357505 LENGTH 376 SQ:AASEQ MVELNLKNIYKKYPNSEHYSVEDFNLNIKDKEXIVFVGPSGCGKSTTLRMIAGLEDITEGTASIDGVVVNDVXPXDRDIAMVFQNYALYPHMTVYDNMAFGLKLRKYSKEDINKRVQEAAEILGLKEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVSMRAEIAKIHRRIGATTIYVTHDQTEAMTLADRIVIMSATKNPAGTGTIGRVEQIGTPQEVYKNPVNKFVAGFIGSPAMNFINVKLVGSEIVSDGFRLKVPEGALKVLREKGYEGKELIFGIRPEDVNAEPAFLETFPDCVVKATISVSELLGSESHLYCQVGKXEFVAKVDARDYLQTGATVELGFDLNKAHFFDVETEKTIY GT:EXON 1|1-376:0| BL:SWS:NREP 1 BL:SWS:REP 1->375|MSMK_STRMU|e-153|72.5|375/377| PROS 136->150|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 65->78|dgvvvndvxpxdrd| BL:PDB:NREP 1 BL:PDB:REP 1->376|1g291|4e-96|52.2|364/372| RP:PDB:NREP 1 RP:PDB:REP 3->376|2d62A|4e-53|40.7|354/361| RP:PFM:NREP 1 RP:PFM:REP 45->164|PF00005|3e-24|46.2|119/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 45->163|PF00005|1.5e-24|36.3|113/118|ABC_tran| HM:PFM:REP 293->367|PF08402|1.8e-10|26.1|69/75|TOBE_2| HM:PFM:REP 17->59|PF03193|3.6e-06|28.6|42/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 2 RP:SCP:REP 4->248|1b0uA|3e-47|30.2|232/258|c.37.1.12| RP:SCP:REP 222->375|1q12A1|7e-23|19.5|118/135|b.40.6.3| HM:SCP:REP 4->246|1g2912|5.7e-66|39.8|231/240|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 248->375|1q12A1|2.1e-27|39.1|115/0|b.40.6.3|1/1|MOP-like| OP:NHOMO 45494 OP:NHOMOORG 1172 OP:PATTERN RQJCRKKLXWXUWSZPkINRKMLXpORegYgSHADDFCIGHFDUXNYfKP**b8SYQUXNRKIDX189 RZiJ*ZXblloSYPYRUML-LdAAU*MMMMMNqmnnr***S*S*o*nblhcOwvuMRa99lqpe*ju***XdXWWxcaaN*fkBAB9CQQNH5KFHJ--GHPJLMZHWIQ99999999BCAAAAHTQJQUKKQSWQdffswGFF*TpkjxedgZhUWIEKFIFabXj***UHKDJIGHKHKHGcUWNLvkATcr*******************yw***clr**dlsssops**VefffgdaeeeeeedXdZXZ*hbd**eOaXgtsPQ**aUPWkjgiiqosrnmwuutpuqqmmsvorraZaZYabcdcbZZyijedeljmlo***********j*mo***ajig*qhxw*emRL**riUZhlRajcmlPcZUNbWYYNIKJHJcU***VQm****y***********-qr*kj*i***RB**************HIK**********QPQQQQQQsUaISdU*66666666454577AB87AA7977A86A6KAEDCC***********xvuwr********h********9Luuo*irlq*o****ZmiMVIQlaJJIIJIISRLUnfds*OdSpiXftcanJdaaUWahWZTSUVnwY*KKLOGLLLMJFCADCCCCCCHSFGJLKoitMnSdJTLtPUXYVKVZURSTTUWWUVW5-CJQQK31-322*x**W*sv**yw***uu-zvtv*uywwv**xqsusrr*****gddkjijkllllmijljji*olmssqtN2y***********43IGDECDEMNMMQG*o*XWVVZWHLNJJQMRYNPQPPERHOSmYrpqqw***q****d***FDDACECCDJfnn*oppppy*y**PMNKLLKKLKCAAA32IUOOGGIJA9788888*AYECBCA-D8DDEFAONKBFOCGF99CXhtWTo*mlmDaN 1233YSF-QH6BIOKEBD9AFKAK9KDBB9A8AHEE7E7A89A776B8DHGCLHBCF97BBB85566526747773512347765556-AC6B99B787873CFEB1EVeiSWTeZaHFECFVLrn9*C**m4pTgKJFAi9IsaDPEBDbBA*GXRRoLm*KsJH9rVd*RaYJFADA*AC89BlVZ*AucA9nUdYD ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,374-377| PSIPRED ccEEEEEEEEEEEccccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEccccccccccEEEEEEcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHccccHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHccEEEEEEcccccccccccEEEEEEccHHHHHHccccHHHHHHcccccEEEEEEEEEccEEEEccEEEEcccccccccccccccccEEEEEEccccEEEcccccccccccEEEEEEEEEEEcccEEEEEEEEccEEEEEEEccccccccccEEEEEEcHHHEEEEccccccccc //