[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55961.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  54/68 : Bacteria  886/915 : Eukaryota  196/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:540 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   6->237,439->505 2ix3A PDBj 5e-18 32.6 %
:RPS:PDB   9->527 3cmvA PDBj 1e-49 9.8 %
:RPS:SCOP  1->259 1b0uA  c.37.1.12 * 1e-28 23.5 %
:RPS:SCOP  319->510 1sgwA  c.37.1.12 * 7e-21 17.9 %
:HMM:SCOP  4->230 1ii8.1 c.37.1.12 * 1.6e-48 32.6 %
:HMM:SCOP  322->514 1ii8.1 c.37.1.12 * 5.1e-34 27.7 %
:RPS:PFM   26->59 PF03193 * DUF258 3e-04 47.1 %
:RPS:PFM   41->184 PF00005 * ABC_tran 7e-06 40.0 %
:HMM:PFM   41->184 PF00005 * ABC_tran 9.9e-20 34.0 106/118  
:HMM:PFM   360->467 PF00005 * ABC_tran 2.7e-12 26.2 103/118  
:HMM:PFM   13->59 PF03193 * DUF258 2.2e-05 21.7 46/161  
:HMM:PFM   228->293 PF08706 * D5_N 0.00015 20.3 64/150  
:HMM:PFM   450->530 PF08716 * nsp7 0.00054 32.5 80/83  
:BLT:SWISS 1->540 YKPA_BACSU 0.0 62.3 %
:PROS 439->453|PS00211|ABC_TRANSPORTER_1
:REPEAT 2|1->250|319->534
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55961.1 GT:GENE ACF55961.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 2066943..2068565 GB:FROM 2066943 GB:TO 2068565 GB:DIRECTION + GB:PRODUCT ABC transporter, ATP-binding protein GB:NOTE identified by match to protein family HMM PF00005 GB:PROTEIN_ID ACF55961.1 GB:DB_XREF GI:194357513 LENGTH 540 SQ:AASEQ MLTVSDVSLRFSDRKLFDDVNIKFTEGNTYGLIGANGAGKSTFLKILAGDIEPTTGHISLGPDERLSVLRQNHFDYEDERAIDVVIMGNEKLYSIMKEKDAIYMKEDFSDEDGVRAAELEGEFAELGGWEAESEASQLLQNLNIPEELHYQNMSELANGEKVKVLLAKALFGKPDVLLLDEPTNGLDIQSITWLEDFLIDFDNTVIVVSHDRHFLNKVCTHMADLDFGKIKLYVGNYDFWKESSELAAKLLADRNAKAEEKIKQLQEFVARFSANASKSRQATSRKKMLDKIELEEIVPSSRKYPFINFKAEREIGNDLLTVENLTVKIDGETILDNISFILRPDDKTALIGQNDIQTTALIRAIMGDIDYEGTVKWGVTTSQSYLPKDNSXDFAGGESILDWLRQFASKXEDDNTFLRGFLGRMLFSGDEVNKPVNVLSGGEKVRVMLSKLMLLKSNVLVLDDPTNHLDLESISSLNDGLKNFKESIIFASHDHEFIQTLANHIIVLSKNGVIDRIDETYDEFLENAEVQAKVKELWKD GT:EXON 1|1-540:0| BL:SWS:NREP 1 BL:SWS:REP 1->540|YKPA_BACSU|0.0|62.3|538/540| PROS 439->453|PS00211|ABC_TRANSPORTER_1|PDOC00185| NREPEAT 1 REPEAT 2|1->250|319->534| SEG 116->132|aaelegefaelggweae| BL:PDB:NREP 1 BL:PDB:REP 6->237,439->505|2ix3A|5e-18|32.6|254/972| RP:PDB:NREP 1 RP:PDB:REP 9->527|3cmvA|1e-49|9.8|511/1190| RP:PFM:NREP 2 RP:PFM:REP 26->59|PF03193|3e-04|47.1|34/160|DUF258| RP:PFM:REP 41->184|PF00005|7e-06|40.0|110/123|ABC_tran| HM:PFM:NREP 5 HM:PFM:REP 41->184|PF00005|9.9e-20|34.0|106/118|ABC_tran| HM:PFM:REP 360->467|PF00005|2.7e-12|26.2|103/118|ABC_tran| HM:PFM:REP 13->59|PF03193|2.2e-05|21.7|46/161|DUF258| HM:PFM:REP 228->293|PF08706|0.00015|20.3|64/150|D5_N| HM:PFM:REP 450->530|PF08716|0.00054|32.5|80/83|nsp7| GO:PFM:NREP 4 GO:PFM GO:0003924|"GO:GTPase activity"|PF03193|IPR004881| GO:PFM GO:0005525|"GO:GTP binding"|PF03193|IPR004881| GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 2 RP:SCP:REP 1->259|1b0uA|1e-28|23.5|251/258|c.37.1.12| RP:SCP:REP 319->510|1sgwA|7e-21|17.9|187/200|c.37.1.12| HM:SCP:REP 4->230|1ii8.1|1.6e-48|32.6|218/370|c.37.1.12|1/2|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 322->514|1ii8.1|5.1e-34|27.7|188/370|c.37.1.12|2/2|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 6469 OP:NHOMOORG 1137 OP:PATTERN 111-3--12222322331----144226513151312121-2-1211613851-11-2-112216--1 3551994666647553333-3522353333335555896617464537754456646511454486758B5633387783951133216686-7453-1759656877271333333332333354432432344434446221623313115122222222224-35463333235431233353--42224DEEGEFHEFEHFFGKG87AAABFGD657GF8BEBCDDC9J9CCCACC9CCCCCCC7BD99D758987687BAA5599A58496899789D97BAFG8AA98998A895555755565555BA9888AAA83EBDHDDDFEIEBJB9CCC7887K839G25C3-CB681157-186834976-645552233374898447775665544535443C-454544444832B889BC6AB8B7553545544444544444444443444344511111111--3233332342214421---2243336553466666474444665644444495764892255534344647364555434364454366533354684845333437444277565569555567736833625666532322222324622833695555667675567555756654566555--4343311-11188784A77888788877-87777687778888878889AA677976777677777777776E87777774-535556665555-1442322246554565955456336655333444334345565888576656666674657323343442756794444489ABA3444344333444422337755442221221292611-21-334113-766244-32---378453E244-52 1211556-74315676545555556555555555555544544454555455565555544444544444444545525545555555-5655555444454596A14S56555387453343233383XW5-6673321433572334162184823538B35343433D45453AAF*FCG6895BG5C7DE9778G ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--- DISOP:02AL 253-262,264-266,269-300,535-541| PSIPRED cEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHcccccccccEEEEccccEEEEEEccccccccccHHHHHHHcHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHcccHHHccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEEccHHHHHHHccEEEEEEccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEccccccccccEEEEEccEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHcccccccEEEEccccEEEEEEccccccccccccHHHHHHHccccccHHHHHHHHHHHHccccHHHHHccHHHccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEcccHHHHHHHccEEEEEEccEEEEEEcccHHHHHHHHHHHHHHHHHHcc //