[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55964.1
DDBJ      :             3-isopropylmalate dehydratase small subunit
Swiss-Prot:LEUD_STRPN   RecName: Full=Putative 3-isopropylmalate dehydratase small subunit;         EC=4.2.1.33;AltName: Full=Isopropylmalate isomerase;AltName: Full=Alpha-IPM isomerase;         Short=IPMI;

Homologs  Archaea  2/68 : Bacteria  566/915 : Eukaryota  94/199 : Viruses  0/175   --->[See Alignment]
c.8.2
:119 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->94 2hcuA PDBj 8e-43 78.5 %
:RPS:PDB   3->115 2b3yA PDBj 3e-25 22.5 %
:RPS:SCOP  3->117 1v7lA  c.8.2.1 * 2e-19 34.7 %
:HMM:SCOP  3->118 1acoA1 c.8.2.1 * 1.4e-29 37.7 %
:RPS:PFM   3->45 PF00694 * Aconitase_C 7e-07 55.8 %
:HMM:PFM   3->46 PF00694 * Aconitase_C 1.5e-21 56.8 44/131  
:HMM:PFM   30->68 PF08059 * SEP 0.00048 25.6 39/75  
:BLT:SWISS 1->119 LEUD_STRPN 3e-65 97.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55964.1 GT:GENE ACF55964.1 GT:PRODUCT 3-isopropylmalate dehydratase small subunit GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1125128..1125487) GB:FROM 1125128 GB:TO 1125487 GB:DIRECTION - GB:PRODUCT 3-isopropylmalate dehydratase small subunit GB:PROTEIN_ID ACF55964.1 GB:DB_XREF GI:194357516 LENGTH 119 SQ:AASEQ MAGSSREHAAWALADYGFKVVIAGSFGDIHYNNELNNDLLPIVQPREVREKLAQLKPTDQVTVDLEQQKIISPVEEFTFEIDSEWKHKLLNSLDDIGITLQYEELIAAYEKQRPAYWQD GT:EXON 1|1-119:0| SW:ID LEUD_STRPN SW:DE RecName: Full=Putative 3-isopropylmalate dehydratase small subunit; EC=4.2.1.33;AltName: Full=Isopropylmalate isomerase;AltName: Full=Alpha-IPM isomerase; Short=IPMI; SW:GN Name=leuD; OrderedLocusNames=SP_1255; SW:KW Amino-acid biosynthesis; Branched-chain amino acid biosynthesis;Complete proteome; Leucine biosynthesis; Lyase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->119|LEUD_STRPN|3e-65|97.5|119/119| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009082|"GO:branched chain family amino acid biosynthetic process"|Branched-chain amino acid biosynthesis| GO:SWS GO:0009098|"GO:leucine biosynthetic process"|Leucine biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| BL:PDB:NREP 1 BL:PDB:REP 2->94|2hcuA|8e-43|78.5|93/177| RP:PDB:NREP 1 RP:PDB:REP 3->115|2b3yA|3e-25|22.5|111/888| RP:PFM:NREP 1 RP:PFM:REP 3->45|PF00694|7e-07|55.8|43/130|Aconitase_C| HM:PFM:NREP 2 HM:PFM:REP 3->46|PF00694|1.5e-21|56.8|44/131|Aconitase_C| HM:PFM:REP 30->68|PF08059|0.00048|25.6|39/75|SEP| GO:PFM:NREP 1 GO:PFM GO:0008152|"GO:metabolic process"|PF00694|IPR000573| RP:SCP:NREP 1 RP:SCP:REP 3->117|1v7lA|2e-19|34.7|98/162|c.8.2.1| HM:SCP:REP 3->118|1acoA1|1.4e-29|37.7|114/0|c.8.2.1|1/1|LeuD/IlvD-like| OP:NHOMO 723 OP:NHOMOORG 662 OP:PATTERN ------------------------------------------------------------------11 1111111111111111111-111111111111111111221111111--111111111--111111111111111111----1-----111111---11--1-11111-1--------------------------11111---1----------------------------------------------11111111111111111111111111111111--11111111-1111111111111111111-------1------------1111-1-------11111111111111-------------111111111-----------------------------1--------------------1--12111-----212221111111111111111111-11111311111-1112111111112143122111111121111111111111111-----------------------------111311132211112111111111211111-1214214311221111111111122211111211111111111111--1---------------------1111---------11111---------------111111111-2111111111111111111111---1111-11--111111111111111111-11-1111111111111111111111111111111111111111111111111-11111111111111-1---------11111111112-11111111111111111111111111221112111111-1-11-1-11111111111111111111111111111111-221111------------------------------------------------- --------------111111111111111111111111-1-11111--11111111111111111111-11211111-1111111111-11111111111111112--1---------------------------------------------------------------------1911-------1--11----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 95.8 SQ:SECSTR #cccccTHHHHHHHHTTEEEEEEccccHHHHHHHHHHTcEEEEEcTTccHHHHTccccccEEEcccccccEETTcEEEEEETTccEEEEEEcccHHHHHHHHHTcHHHHHHHHHH#### DISOP:02AL 1-2,119-120| PSIPRED cccccHHHHHHHHHHcccEEEEEccHHHHHHHHHHHccccEEEEcHHHHHHHHccccccEEEEEccccEEEEccEEEEEEEcHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHcc //