[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55965.1
DDBJ      :             transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:126 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   48->103 1z9cC PDBj 8e-04 33.3 %
:RPS:PDB   23->112 2d1hB PDBj 2e-09 18.2 %
:RPS:SCOP  1->119 1hsjA1  a.4.5.28 * 7e-12 18.4 %
:HMM:SCOP  2->119 1fzpB_ a.4.5.28 * 1.3e-17 34.5 %
:RPS:PFM   44->95 PF01047 * MarR 3e-04 46.0 %
:HMM:PFM   34->94 PF01047 * MarR 1.5e-11 42.1 57/59  
:BLT:SWISS 14->103 YUSO_BACSU 8e-06 30.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55965.1 GT:GENE ACF55965.1 GT:PRODUCT transcriptional regulator, MarR family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1607016..1607396 GB:FROM 1607016 GB:TO 1607396 GB:DIRECTION + GB:PRODUCT transcriptional regulator, MarR family GB:NOTE identified by match to protein family HMM PF01047 GB:PROTEIN_ID ACF55965.1 GB:DB_XREF GI:194357517 LENGTH 126 SQ:AASEQ MTYLEKWFDFNRRQKEIESLLEETIAQQSEQSLTLKEFYLLYYLDLAEEKSLRQIDLPDKLHLSPSAVSRMVARLEAKNCGLLSRMCCHQDRRSSFICLTNDGQKTLASLQKTVEESLEAGLDFLI GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 14->103|YUSO_BACSU|8e-06|30.2|86/155| BL:PDB:NREP 1 BL:PDB:REP 48->103|1z9cC|8e-04|33.3|54/138| RP:PDB:NREP 1 RP:PDB:REP 23->112|2d1hB|2e-09|18.2|88/96| RP:PFM:NREP 1 RP:PFM:REP 44->95|PF01047|3e-04|46.0|50/59|MarR| HM:PFM:NREP 1 HM:PFM:REP 34->94|PF01047|1.5e-11|42.1|57/59|MarR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01047|IPR000835| GO:PFM GO:0005622|"GO:intracellular"|PF01047|IPR000835| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01047|IPR000835| RP:SCP:NREP 1 RP:SCP:REP 1->119|1hsjA1|7e-12|18.4|114/115|a.4.5.28| HM:SCP:REP 2->119|1fzpB_|1.3e-17|34.5|113/115|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-----------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------1---1------------------------------------11111-11111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 96.8 SQ:SECSTR ###ccHHHHHHHHHHHHHHHHHTTTHHHHHHHHTccHHHHHHHHHHHHTccccHHHHHHHHTccHHHHHHHHHHHHHTTTTcEEEEEcccEEEEEcTTHHHHHHHHHHHHHHHHHHHHHHHTTTc# PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHHccEEEEEEcccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHc //