[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55969.1
DDBJ      :             ABC transporter, substrate-binding protein
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  496/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:266 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->258 2o1mA PDBj 2e-18 25.0 %
:RPS:PDB   6->257 2a5sA PDBj 7e-34 16.0 %
:RPS:SCOP  32->255 1gggA  c.94.1.1 * 8e-32 19.8 %
:HMM:SCOP  1->259 2a5sA1 c.94.1.1 * 1.1e-44 29.8 %
:RPS:PFM   34->249 PF00497 * SBP_bac_3 6e-22 34.4 %
:HMM:PFM   32->255 PF00497 * SBP_bac_3 2.9e-50 28.9 218/225  
:BLT:SWISS 19->258 TCYJ_BACSU 3e-24 28.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55969.1 GT:GENE ACF55969.1 GT:PRODUCT ABC transporter, substrate-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(550176..550976) GB:FROM 550176 GB:TO 550976 GB:DIRECTION - GB:PRODUCT ABC transporter, substrate-binding protein GB:NOTE identified by match to protein family HMM PF00497 GB:PROTEIN_ID ACF55969.1 GB:DB_XREF GI:194357521 LENGTH 266 SQ:AASEQ MKKFSLLLAILPFLVACGNQATPKESSSQKTIVLATAGDVPPFDYEDKGNLTGFDIEVLKAVDEKLSDYEIQFQRTAWESIFPGLDSGHYQAAANNLSYTKERAEKYLYSLPISNNPLVLVSNKKNPLTSLDQIAGKTTQEDTGTSNAQFINHWNQKHTDNPATIDFSGEDIGKRILDLANGEFDFLVFDKVSVQKIIKDRGLDLSVVDLPXADSPSNYIIFSSDQKEFKEKFDKALKELYQDGTLEKLSNTYLGGSYLPDQSQLQ GT:EXON 1|1-266:0| BL:SWS:NREP 1 BL:SWS:REP 19->258|TCYJ_BACSU|3e-24|28.9|228/269| BL:PDB:NREP 1 BL:PDB:REP 30->258|2o1mA|2e-18|25.0|224/229| RP:PDB:NREP 1 RP:PDB:REP 6->257|2a5sA|7e-34|16.0|250/278| RP:PFM:NREP 1 RP:PFM:REP 34->249|PF00497|6e-22|34.4|209/222|SBP_bac_3| HM:PFM:NREP 1 HM:PFM:REP 32->255|PF00497|2.9e-50|28.9|218/225|SBP_bac_3| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 32->255|1gggA|8e-32|19.8|217/220|c.94.1.1| HM:SCP:REP 1->259|2a5sA1|1.1e-44|29.8|255/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1415 OP:NHOMOORG 513 OP:PATTERN -----1------------1----12-----1-1-----1331--1111----1----1---------- --------------1------1---1------1111--12----1----11-222111------------11---1-----11--------------------------------------------------------111111---1---1-----------1--111-------------111-1----2523333353234433422325633411255343333328211111111111111111112212-45141-133225424147133344445651766666666665644443444444443558775556-223234334431311244-222-2-1-----122-3-21--11111125---1---1211211-----------5552526556B--------113-1833674476656-----1-3-1---1-11111111------11---------------------------1-------15333555555-11114459111111728342-----1-1-11--12-1--2----232222222-------13--32422422212-2--2----------1-43322222221-1111111-------431-1-----2-------1111--1-----1---1--------43583555554543455-5555555455545455446776443313223333333433334554344553-634444443444--1--1---1111--13-11121111111111-11111--264--11112733344432333----------21121111131221-----------------4--------------1-1-----------------------------1-1------ -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 266 STR:RPRED 100.0 SQ:SECSTR TEEEEEEcccTTTcEEEEccccccccTTcEEEEEEEEcccccccEEEEEEEEcHHHHHHHHHHHHHTcccccEETTEEcHHHHHHHTTcccEEcccccccHHHHTTEEEccccEEEcEEEEEETTcccccGGccccccEEccTTcHHHHHHHTTcHHHHHHHGGGccEEccHHHHHHHHHTTcccEEEEEHHHHHHHHHcTTccEEEEEcccGGGcEEEccEEETTcTTHHHHHHHHHHHHHHTHHHHHHHHHTccccccccccHH DISOP:02AL 261-267| PSIPRED cHHHHHHHHHHHHHHHHcccccHHHHHHcccEEEEEEcccccEEEEEccEEEEEHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHcccccEEEccccccHHHHHHHHHcccEEEccEEEEEEcccccccHHHHcccEEEEEcccHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHcccccEEEEcHHHHHHHHHHccccEEEEcccccccccEEEEEEcccHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccc //