[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55984.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:156 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->155 PF11217 * DUF3013 8e-49 69.0 %
:HMM:PFM   1->155 PF11217 * DUF3013 1.1e-66 56.1 155/160  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55984.1 GT:GENE ACF55984.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1616201..1616671) GB:FROM 1616201 GB:TO 1616671 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF55984.1 GB:DB_XREF GI:194357536 LENGTH 156 SQ:AASEQ MATYGFLDVLEEELDKNFPFDFEISWDKRNHAVEVSFLLEAQNAAGVEMVDEDGEVSSDDILFEEAVLFYNPAKSTVNAEDYLTVIPYLPKKGFSREFLAYFAIFLKDTAEVGLDTLMDFLEDPEAEEFVMEWNQEVFEEGKVGLEEGEFYPYPRY GT:EXON 1|1-156:0| RP:PFM:NREP 1 RP:PFM:REP 1->155|PF11217|8e-49|69.0|155/155|DUF3013| HM:PFM:NREP 1 HM:PFM:REP 1->155|PF11217|1.1e-66|56.1|155/160|DUF3013| OP:NHOMO 54 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11---------1111----11111111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccccHHHHHHHHHHHcccccEEEEEEcccccEEEEEEEEEEEccccEEEEccccccccccEEEEEEEEEEccccccccHHHcEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcHHHHHHHHHHccHHHccccccc //