[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55997.1
DDBJ      :             type II restriction-modification system regulatory protein, putative
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:53 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->49 2b5aC PDBj 5e-05 31.9 %
:RPS:PDB   9->49 5croO PDBj 2e-08 29.3 %
:RPS:SCOP  9->49 1d1lA  a.35.1.2 * 5e-08 29.3 %
:HMM:SCOP  1->49 1y9qA1 a.35.1.8 * 5.5e-09 32.7 %
:RPS:PFM   13->47 PF01381 * HTH_3 8e-04 45.7 %
:HMM:PFM   13->49 PF01381 * HTH_3 8.5e-11 43.2 37/55  
:BLT:SWISS 10->49 CEBA_BACAM 1e-04 35.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55997.1 GT:GENE ACF55997.1 GT:PRODUCT type II restriction-modification system regulatory protein, putative GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1757810..1757971) GB:FROM 1757810 GB:TO 1757971 GB:DIRECTION - GB:PRODUCT type II restriction-modification system regulatory protein, putative GB:PROTEIN_ID ACF55997.1 GB:DB_XREF GI:194357549 LENGTH 53 SQ:AASEQ MNMINVCDVGKRIKELRISSNLTQDKIAEYLSLNQSMIAKMEKGERNITNGFK GT:EXON 1|1-53:0| BL:SWS:NREP 1 BL:SWS:REP 10->49|CEBA_BACAM|1e-04|35.0|40/102| BL:PDB:NREP 1 BL:PDB:REP 3->49|2b5aC|5e-05|31.9|47/76| RP:PDB:NREP 1 RP:PDB:REP 9->49|5croO|2e-08|29.3|41/60| RP:PFM:NREP 1 RP:PFM:REP 13->47|PF01381|8e-04|45.7|35/55|HTH_3| HM:PFM:NREP 1 HM:PFM:REP 13->49|PF01381|8.5e-11|43.2|37/55|HTH_3| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 1 RP:SCP:REP 9->49|1d1lA|5e-08|29.3|41/61|a.35.1.2| HM:SCP:REP 1->49|1y9qA1|5.5e-09|32.7|49/0|a.35.1.8|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 51 STR:RPRED 96.2 SQ:SECSTR ccHHHHHHccEEEEHHHHHHHHHHHHHHHHHTccHHHHHHHHHTTccEEHH## DISOP:02AL 1-1,47-54| PSIPRED ccEEEHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHccHHHHHccc //