[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56000.1
DDBJ      :             PTS system, IIA component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  243/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.54.1
:134 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->101 1pdoA PDBj 2e-13 31.0 %
:RPS:PDB   6->124 3bedB PDBj 7e-24 28.3 %
:RPS:SCOP  5->124 3bedA1  c.54.1.1 * 1e-32 37.5 %
:HMM:SCOP  2->122 1pdoA_ c.54.1.1 * 4e-27 37.2 %
:RPS:PFM   5->101 PF03610 * EIIA-man 2e-16 42.3 %
:HMM:PFM   4->109 PF03610 * EIIA-man 5.2e-33 39.8 103/116  
:BLT:SWISS 5->131 PTNAB_STRP6 2e-16 34.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56000.1 GT:GENE ACF56000.1 GT:PRODUCT PTS system, IIA component GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 67423..67827 GB:FROM 67423 GB:TO 67827 GB:DIRECTION + GB:PRODUCT PTS system, IIA component GB:NOTE identified by match to protein family HMM PF03610 GB:PROTEIN_ID ACF56000.1 GB:DB_XREF GI:194357552 LENGTH 134 SQ:AASEQ MTKSLILVSHGRFCEELRGSTEMIMGPQDNIYTVALLPEDGPEEFTAKFEAVIEGLDDFLVFADLLGGTPCNVVSRLIMEGRDIDLYAGMNLPMVIEFINASLTGADADYKSRAAESIVKVNDLLAGFDDDEDE GT:EXON 1|1-134:0| BL:SWS:NREP 1 BL:SWS:REP 5->131|PTNAB_STRP6|2e-16|34.6|127/330| BL:PDB:NREP 1 BL:PDB:REP 2->101|1pdoA|2e-13|31.0|100/129| RP:PDB:NREP 1 RP:PDB:REP 6->124|3bedB|7e-24|28.3|113/118| RP:PFM:NREP 1 RP:PFM:REP 5->101|PF03610|2e-16|42.3|97/117|EIIA-man| HM:PFM:NREP 1 HM:PFM:REP 4->109|PF03610|5.2e-33|39.8|103/116|EIIA-man| GO:PFM:NREP 2 GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF03610|IPR004701| GO:PFM GO:0016021|"GO:integral to membrane"|PF03610|IPR004701| RP:SCP:NREP 1 RP:SCP:REP 5->124|3bedA1|1e-32|37.5|120/132|c.54.1.1| HM:SCP:REP 2->122|1pdoA_|4e-27|37.2|121/129|c.54.1.1|1/1|IIA domain of mannose transporter, IIA-Man| OP:NHOMO 325 OP:NHOMOORG 243 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------1---------11-1-------1--323333----------------------51-1271121222--42-2211211111123331113333333332311111111111111111111112---15-------3-2-3---111---1-2--------------11--1-2---111--111-111--1111111111111111111-11111111111-11111111111111--1----------------------1111------------------------------11111-------------------------------------------------------------------1---------1---1--------1---1----1--1----------------------------------------------------------------------11-111-1111111111-1-11111111111111111111111111111111111111111111111112-1-----------111---------------222212-----2111----------------------------------------------------------------------2------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 92.5 SQ:SECSTR ccEEEEEEEETTHHHHHHHHHHHHHGGGcccEEEEEcTTTHHHHHHHHHHHHHHHHcccEEEEEccTcHHHHHHHTTcTccTTEEEEEcccHHHHHHHHcccccHHHHHHHHHHHHHTcccccc########## DISOP:02AL 125-135| PSIPRED ccEEEEEEEcHHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHccccEEEEEcccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccc //